Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2627884..2628086 | Replicon | chromosome |
Accession | NZ_CP028361 | ||
Organism | Clostridioides difficile strain DSM 105001 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | DSM105001_RS12530 | Protein ID | WP_004454589.1 |
Coordinates | 2627934..2628086 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2627884..2628013 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DSM105001_RS12500 | 2623133..2623450 | + | 318 | WP_009897465.1 | hypothetical protein | - |
DSM105001_RS12505 | 2623586..2624050 | + | 465 | WP_004454576.1 | hypothetical protein | - |
DSM105001_RS12510 | 2624379..2624540 | - | 162 | WP_004454578.1 | hypothetical protein | - |
DSM105001_RS12515 | 2624592..2625406 | - | 815 | Protein_2387 | toxin Bro | - |
DSM105001_RS12520 | 2625526..2625678 | - | 153 | WP_009897477.1 | hypothetical protein | - |
DSM105001_RS12525 | 2626817..2627740 | - | 924 | WP_021364626.1 | SHOCT domain-containing protein | - |
- | 2627884..2628013 | + | 130 | NuclAT_3 | - | Antitoxin |
DSM105001_RS12530 | 2627934..2628086 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
DSM105001_RS12535 | 2628360..2628683 | - | 324 | WP_021364628.1 | hypothetical protein | - |
DSM105001_RS12540 | 2628719..2628973 | - | 255 | WP_004454592.1 | hypothetical protein | - |
DSM105001_RS12545 | 2629405..2629923 | - | 519 | Protein_2393 | transposase | - |
DSM105001_RS12550 | 2630213..2630587 | - | 375 | Protein_2394 | BlaI/MecI/CopY family transcriptional regulator | - |
DSM105001_RS12555 | 2630692..2631069 | - | 378 | WP_021364350.1 | BlaI/MecI/CopY family transcriptional regulator | - |
DSM105001_RS12560 | 2631874..2632368 | + | 495 | WP_021364347.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
DSM105001_RS12565 | 2632757..2632927 | + | 171 | WP_021416406.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2621312..2638176 | 16864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T101036 WP_004454589.1 NZ_CP028361:c2628086-2627934 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T101036 NZ_CP028361:c2628086-2627934 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT101036 NZ_CP028361:2627884-2628013 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|