Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2510725..2510927 | Replicon | chromosome |
Accession | NZ_CP012320 | ||
Organism | Clostridioides difficile strain DSM 28196 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF28196_RS12035 | Protein ID | WP_004454589.1 |
Coordinates | 2510775..2510927 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2510725..2510854 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF28196_RS12010 | 2506159..2506623 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CDIF28196_RS12020 | 2506951..2507112 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF28196_RS12025 | 2507164..2507977 | - | 814 | Protein_2214 | toxin Bro | - |
CDIF28196_RS19830 | 2508097..2508249 | - | 153 | WP_021361915.1 | hypothetical protein | - |
CDIF28196_RS12030 | 2509658..2510581 | - | 924 | WP_011861517.1 | SHOCT domain-containing protein | - |
- | 2510725..2510854 | + | 130 | NuclAT_0 | - | Antitoxin |
CDIF28196_RS12035 | 2510775..2510927 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF28196_RS12040 | 2511201..2511524 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF28196_RS12045 | 2511560..2511814 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF28196_RS12055 | 2512250..2512768 | - | 519 | Protein_2220 | transposase | - |
CDIF28196_RS12060 | 2513058..2513433 | - | 376 | Protein_2221 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF28196_RS12065 | 2513538..2513915 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF28196_RS12070 | 2514719..2515213 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF28196_RS12075 | 2515602..2515772 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2502581..2524109 | 21528 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T56274 WP_004454589.1 NZ_CP012320:c2510927-2510775 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T56274 NZ_CP012320:c2510927-2510775 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT56274 NZ_CP012320:2510725-2510854 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|