Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2622518..2622720 | Replicon | chromosome |
Accession | NZ_CP016318 | ||
Organism | Clostridioides difficile strain 630 delta erm |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF630erm_RS20725 | Protein ID | WP_004454589.1 |
Coordinates | 2622568..2622720 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2622518..2622647 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF630erm_RS12640 | 2617952..2618416 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CDIF630erm_RS20715 | 2618744..2618905 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF630erm_RS12655 | 2618957..2619770 | - | 814 | Protein_2354 | toxin Bro | - |
CDIF630erm_RS20720 | 2619890..2620042 | - | 153 | WP_021361915.1 | hypothetical protein | - |
CDIF630erm_RS12660 | 2621451..2622374 | - | 924 | WP_011861517.1 | SHOCT domain-containing protein | - |
- | 2622518..2622647 | + | 130 | NuclAT_9 | - | Antitoxin |
CDIF630erm_RS20725 | 2622568..2622720 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF630erm_RS12670 | 2622994..2623317 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF630erm_RS12675 | 2623353..2623607 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF630erm_RS12680 | 2624043..2624561 | - | 519 | Protein_2360 | transposase | - |
CDIF630erm_RS20430 | 2624851..2625226 | - | 376 | Protein_2361 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF630erm_RS12690 | 2625331..2625708 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF630erm_RS12695 | 2626512..2627006 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF630erm_RS20435 | 2627395..2627565 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2615678..2631316 | 15638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T64409 WP_004454589.1 NZ_CP016318:c2622720-2622568 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T64409 NZ_CP016318:c2622720-2622568 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT64409 NZ_CP016318:2622518-2622647 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|