Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2649826..2650028 | Replicon | chromosome |
Accession | NZ_CP010905 | ||
Organism | Clostridioides difficile 630 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF630_RS20565 | Protein ID | WP_004454589.1 |
Coordinates | 2649876..2650028 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2649826..2649955 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF630_RS12755 | 2645260..2645724 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CDIF630_RS20555 | 2646052..2646213 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF630_RS12770 | 2646265..2647078 | - | 814 | Protein_2374 | toxin Bro | - |
CDIF630_RS20560 | 2647198..2647350 | - | 153 | WP_021361915.1 | hypothetical protein | - |
CDIF630_RS12775 | 2648759..2649682 | - | 924 | WP_011861517.1 | SHOCT domain-containing protein | - |
- | 2649826..2649955 | + | 130 | NuclAT_9 | - | Antitoxin |
CDIF630_RS20565 | 2649876..2650028 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF630_RS12785 | 2650302..2650625 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF630_RS12790 | 2650661..2650915 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF630_RS12795 | 2651351..2651869 | - | 519 | Protein_2380 | transposase | - |
CDIF630_RS20280 | 2652159..2652534 | - | 376 | Protein_2381 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF630_RS12805 | 2652639..2653016 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF630_RS12810 | 2653820..2654314 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF630_RS20285 | 2654703..2654873 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2642986..2663210 | 20224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T53087 WP_004454589.1 NZ_CP010905:c2650028-2649876 [Clostridioides difficile 630]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T53087 NZ_CP010905:c2650028-2649876 [Clostridioides difficile 630]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT53087 NZ_CP010905:2649826-2649955 [Clostridioides difficile 630]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|