Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2622519..2622721 | Replicon | chromosome |
Accession | NZ_LN614756 | ||
Organism | Clostridioides difficile strain 630Derm |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CD630DERM_RS21000 | Protein ID | WP_004454589.1 |
Coordinates | 2622569..2622721 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2622519..2622648 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CD630DERM_RS12420 | 2617953..2618417 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CD630DERM_RS20990 | 2618745..2618906 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CD630DERM_RS20280 | 2618958..2619771 | - | 814 | Protein_2353 | toxin Bro | - |
CD630DERM_RS20995 | 2619891..2620043 | - | 153 | WP_021361915.1 | hypothetical protein | - |
CD630DERM_RS12440 | 2621452..2622375 | - | 924 | WP_011861517.1 | SHOCT domain-containing protein | - |
- | 2622519..2622648 | + | 130 | NuclAT_9 | - | Antitoxin |
CD630DERM_RS21000 | 2622569..2622721 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CD630DERM_RS12450 | 2622995..2623318 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CD630DERM_RS12455 | 2623354..2623608 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CD630DERM_RS12460 | 2624044..2624562 | - | 519 | Protein_2359 | transposase | - |
CD630DERM_RS20695 | 2624852..2625227 | - | 376 | Protein_2360 | BlaI/MecI/CopY family transcriptional regulator | - |
CD630DERM_RS12470 | 2625332..2625709 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CD630DERM_RS12475 | 2626513..2627007 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CD630DERM_RS20700 | 2627396..2627566 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2615679..2631317 | 15638 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T285471 WP_004454589.1 NZ_LN614756:c2622721-2622569 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
Antitoxin
Download Length: 130 bp
>AT285471 NZ_LN614756:2622519-2622648 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|