Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2419057..2419259 | Replicon | chromosome |
Accession | NZ_CP025047 | ||
Organism | Clostridioides difficile strain W0003a |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CWR54_RS11305 | Protein ID | WP_004454589.1 |
Coordinates | 2419107..2419259 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2419057..2419186 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CWR54_RS11275 | 2414174..2414491 | + | 318 | WP_009897465.1 | hypothetical protein | - |
CWR54_RS11280 | 2414627..2415091 | + | 465 | WP_011861514.1 | hypothetical protein | - |
CWR54_RS11290 | 2415419..2415580 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CWR54_RS11295 | 2415632..2416445 | - | 814 | Protein_2131 | toxin Bro | - |
CWR54_RS18900 | 2416565..2416717 | - | 153 | WP_021361915.1 | hypothetical protein | - |
CWR54_RS11300 | 2417990..2418913 | - | 924 | WP_004454587.1 | SHOCT domain-containing protein | - |
- | 2419057..2419186 | + | 130 | NuclAT_1 | - | Antitoxin |
CWR54_RS11305 | 2419107..2419259 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CWR54_RS11310 | 2419533..2419856 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CWR54_RS11315 | 2419892..2420146 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CWR54_RS11325 | 2420578..2421096 | - | 519 | Protein_2137 | transposase | - |
CWR54_RS11330 | 2421386..2421760 | - | 375 | Protein_2138 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR54_RS11335 | 2421865..2422239 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CWR54_RS11340 | 2423043..2423531 | + | 489 | WP_004454599.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CWR54_RS18855 | 2423920..2424090 | + | 171 | WP_021394397.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2411049..2429337 | 18288 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T89618 WP_004454589.1 NZ_CP025047:c2419259-2419107 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T89618 NZ_CP025047:c2419259-2419107 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT89618 NZ_CP025047:2419057-2419186 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|