Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2558298..2558500 | Replicon | chromosome |
Accession | NZ_CP042267 | ||
Organism | Clostridioides difficile strain Mta-79 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | FQN08_RS12300 | Protein ID | WP_004454589.1 |
Coordinates | 2558348..2558500 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2558298..2558427 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQN08_RS12265 | 2553424..2553741 | + | 318 | WP_004454574.1 | hypothetical protein | - |
FQN08_RS12270 | 2553877..2554341 | + | 465 | WP_032508861.1 | hypothetical protein | - |
FQN08_RS12280 | 2554670..2554831 | - | 162 | WP_004454578.1 | hypothetical protein | - |
FQN08_RS19290 | 2554883..2555697 | - | 815 | Protein_2295 | toxin Bro | - |
FQN08_RS19295 | 2555818..2556006 | - | 189 | WP_004454585.1 | hypothetical protein | - |
FQN08_RS12295 | 2557247..2558154 | - | 908 | Protein_2297 | SHOCT domain-containing protein | - |
- | 2558298..2558427 | + | 130 | NuclAT_1 | - | Antitoxin |
FQN08_RS12300 | 2558348..2558500 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
FQN08_RS12305 | 2558773..2559096 | - | 324 | WP_009897482.1 | hypothetical protein | - |
FQN08_RS12310 | 2559132..2559386 | - | 255 | WP_004454592.1 | hypothetical protein | - |
FQN08_RS12320 | 2559826..2560344 | - | 519 | Protein_2301 | transposase | - |
FQN08_RS12325 | 2560634..2561009 | - | 376 | Protein_2302 | BlaI/MecI/CopY family transcriptional regulator | - |
FQN08_RS12330 | 2561114..2561491 | - | 378 | WP_011861518.1 | BlaI/MecI/CopY family transcriptional regulator | - |
FQN08_RS12335 | 2562295..2562789 | + | 495 | WP_011861519.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
FQN08_RS12340 | 2563178..2563348 | + | 171 | WP_004454601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2551603..2568597 | 16994 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T135127 WP_004454589.1 NZ_CP042267:c2558500-2558348 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T135127 NZ_CP042267:c2558500-2558348 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT135127 NZ_CP042267:2558298-2558427 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|