Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 3076077..3076279 | Replicon | chromosome |
Accession | NZ_CP010888 | ||
Organism | Clostridioides difficile strain 08ACD0030 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | TW87_RS14615 | Protein ID | WP_004454589.1 |
Coordinates | 3076127..3076279 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 3076077..3076206 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TW87_RS14585 | 3071326..3071643 | + | 318 | WP_009897465.1 | hypothetical protein | - |
TW87_RS14590 | 3071779..3072243 | + | 465 | WP_004454576.1 | hypothetical protein | - |
TW87_RS14595 | 3072572..3072733 | - | 162 | WP_004454578.1 | hypothetical protein | - |
TW87_RS20030 | 3072785..3073599 | - | 815 | Protein_2776 | toxin Bro | - |
TW87_RS20035 | 3073719..3073871 | - | 153 | WP_009897477.1 | hypothetical protein | - |
TW87_RS14610 | 3075010..3075933 | - | 924 | WP_021364626.1 | SHOCT domain-containing protein | - |
- | 3076077..3076206 | + | 130 | NuclAT_3 | - | Antitoxin |
TW87_RS14615 | 3076127..3076279 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
TW87_RS14620 | 3076553..3076876 | - | 324 | WP_021364628.1 | hypothetical protein | - |
TW87_RS14625 | 3076912..3077166 | - | 255 | WP_004454592.1 | hypothetical protein | - |
TW87_RS14630 | 3077598..3078116 | - | 519 | Protein_2782 | transposase | - |
TW87_RS19905 | 3078406..3078780 | - | 375 | Protein_2783 | BlaI/MecI/CopY family transcriptional regulator | - |
TW87_RS14640 | 3078885..3079262 | - | 378 | WP_021364350.1 | BlaI/MecI/CopY family transcriptional regulator | - |
TW87_RS14645 | 3080067..3080561 | + | 495 | WP_021364347.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
TW87_RS19910 | 3080950..3081120 | + | 171 | WP_021416406.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3069505..3086369 | 16864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T53035 WP_004454589.1 NZ_CP010888:c3076279-3076127 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T53035 NZ_CP010888:c3076279-3076127 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT53035 NZ_CP010888:3076077-3076206 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|