Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 2571671..2571873 | Replicon | chromosome |
Accession | NZ_CP019857 | ||
Organism | Clostridioides difficile strain DSM 29745 |
Toxin (Protein)
Gene name | CD2299.1 | Uniprot ID | Q185H1 |
Locus tag | CDIF29745_RS12455 | Protein ID | WP_004454589.1 |
Coordinates | 2571721..2571873 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | SQ1641 | ||
Locus tag | - | ||
Coordinates | 2571671..2571800 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDIF29745_RS12420 | 2567116..2567433 | + | 318 | WP_009897465.1 | hypothetical protein | - |
CDIF29745_RS12425 | 2567569..2568033 | + | 465 | WP_009897467.1 | hypothetical protein | - |
CDIF29745_RS12435 | 2568361..2568522 | - | 162 | WP_004454578.1 | hypothetical protein | - |
CDIF29745_RS20020 | 2568574..2569388 | - | 815 | Protein_2308 | toxin Bro | - |
CDIF29745_RS19930 | 2569508..2569696 | - | 189 | WP_004454585.1 | hypothetical protein | - |
CDIF29745_RS12450 | 2570643..2571527 | - | 885 | WP_009897481.1 | hypothetical protein | - |
- | 2571671..2571800 | + | 130 | NuclAT_1 | - | Antitoxin |
CDIF29745_RS12455 | 2571721..2571873 | - | 153 | WP_004454589.1 | hypothetical protein | Toxin |
CDIF29745_RS12460 | 2572147..2572470 | - | 324 | WP_009897482.1 | hypothetical protein | - |
CDIF29745_RS12465 | 2572506..2572760 | - | 255 | WP_004454592.1 | hypothetical protein | - |
CDIF29745_RS12475 | 2573192..2573710 | - | 519 | Protein_2314 | transposase | - |
CDIF29745_RS12480 | 2574000..2574373 | - | 374 | Protein_2315 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29745_RS12485 | 2574478..2574852 | - | 375 | WP_004454597.1 | BlaI/MecI/CopY family transcriptional regulator | - |
CDIF29745_RS12490 | 2575656..2576144 | + | 489 | WP_009897487.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | - |
CDIF29745_RS12495 | 2576533..2576703 | + | 171 | WP_021394397.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2565295..2581952 | 16657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.92 Da Isoelectric Point: 10.6365
>T73338 WP_004454589.1 NZ_CP019857:c2571873-2571721 [Clostridioides difficile]
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
MDNFLFNVLASVTASYIVYLISKLIKKVKSHSTAKSDLKIDINFKYHRKK
Download Length: 153 bp
>T73338 NZ_CP019857:c2571873-2571721 [Clostridioides difficile]
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
ATGGATAATTTTTTATTTAATGTGTTAGCTAGTGTAACAGCTAGTTACATAGTTTATTTGATTAGCAAGTTAATCAAAAA
AGTAAAAAGCCACTCTACCGCAAAGAGTGACTTAAAGATTGATATAAATTTTAAATATCATCGTAAAAAATAA
Antitoxin
Download Length: 130 bp
>AT73338 NZ_CP019857:2571671-2571800 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
AAGAAGAACTACAATCTATTTGCGGTAGAGTGAAGTTCTATAACTGAAAGTTATTTTTTACGATGATATTTAAAATTTAT
ATCAATCTTTAAGTCACTCTTTGCGGTAGAGTGGCTTTTTACTTTTTTGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|