Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/- |
Location | 1438776..1439259 | Replicon | chromosome |
Accession | NC_012924 | ||
Organism | Streptococcus suis SC84 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D5AIX4 |
Locus tag | SSUSC84_RS07050 | Protein ID | WP_012027435.1 |
Coordinates | 1438776..1439036 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0Z8BIX7 |
Locus tag | SSUSC84_RS07055 | Protein ID | WP_012775256.1 |
Coordinates | 1439038..1439259 (-) | Length | 74 a.a. |
Genomic Context
Location: 1436682..1437686 (1005 bp)
Type: Others
Protein ID: WP_012028380.1
Type: Others
Protein ID: WP_012028380.1
Location: 1437750..1437935 (186 bp)
Type: Others
Protein ID: WP_002935693.1
Type: Others
Protein ID: WP_002935693.1
Location: 1441026..1441478 (453 bp)
Type: Others
Protein ID: WP_012028381.1
Type: Others
Protein ID: WP_012028381.1
Location: 1442940..1443590 (651 bp)
Type: Others
Protein ID: WP_012027441.1
Type: Others
Protein ID: WP_012027441.1
Location: 1434161..1435390 (1230 bp)
Type: Others
Protein ID: WP_012775253.1
Type: Others
Protein ID: WP_012775253.1
Location: 1435380..1436546 (1167 bp)
Type: Others
Protein ID: WP_012775254.1
Type: Others
Protein ID: WP_012775254.1
Location: 1437968..1438609 (642 bp)
Type: Others
Protein ID: WP_012775255.1
Type: Others
Protein ID: WP_012775255.1
Location: 1438776..1439036 (261 bp)
Type: Toxin
Protein ID: WP_012027435.1
Type: Toxin
Protein ID: WP_012027435.1
Location: 1439038..1439259 (222 bp)
Type: Antitoxin
Protein ID: WP_012775256.1
Type: Antitoxin
Protein ID: WP_012775256.1
Location: 1439569..1440876 (1308 bp)
Type: Others
Protein ID: WP_002935704.1
Type: Others
Protein ID: WP_002935704.1
Location: 1441485..1441714 (230 bp)
Type: Others
Protein ID: Protein_1344
Type: Others
Protein ID: Protein_1344
Location: 1441705..1442832 (1128 bp)
Type: Others
Protein ID: WP_012028382.1
Type: Others
Protein ID: WP_012028382.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSUSC84_RS07025 (SSUSC84_1343) | 1434161..1435390 | - | 1230 | WP_012775253.1 | tetratricopeptide repeat protein | - |
SSUSC84_RS07030 (SSUSC84_1344) | 1435380..1436546 | - | 1167 | WP_012775254.1 | AI-2E family transporter | - |
SSUSC84_RS07035 (SSUSC84_1345) | 1436682..1437686 | + | 1005 | WP_012028380.1 | lactonase family protein | - |
SSUSC84_RS07040 (SSUSC84_1346) | 1437750..1437935 | + | 186 | WP_002935693.1 | hypothetical protein | - |
SSUSC84_RS07045 (SSUSC84_1347) | 1437968..1438609 | - | 642 | WP_012775255.1 | HAD family hydrolase | - |
SSUSC84_RS07050 (SSUSC84_1348) | 1438776..1439036 | - | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SSUSC84_RS07055 (SSUSC84_1349) | 1439038..1439259 | - | 222 | WP_012775256.1 | hypothetical protein | Antitoxin |
SSUSC84_RS07060 (SSUSC84_1350) | 1439569..1440876 | - | 1308 | WP_002935704.1 | phosphopyruvate hydratase | - |
SSUSC84_RS07065 (SSUSC84_1351) | 1441026..1441478 | + | 453 | WP_012028381.1 | DUF1694 domain-containing protein | - |
SSUSC84_RS10580 | 1441485..1441714 | - | 230 | Protein_1344 | hypothetical protein | - |
SSUSC84_RS07070 (SSUSC84_1352) | 1441705..1442832 | - | 1128 | WP_012028382.1 | glycerate kinase | - |
SSUSC84_RS07075 (SSUSC84_1353) | 1442940..1443590 | + | 651 | WP_012027441.1 | HAD family hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1444027..1445229 | 1202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10273.79 Da Isoelectric Point: 9.3944
>T10158 WP_012027435.1 NC_012924:c1439036-1438776 [Streptococcus suis SC84]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY
Download Length: 261 bp
>T10158 NC_012924:c1439036-1438776 [Streptococcus suis SC84]
ATGTATCATTTAGAGTATTCTAAAAAGGCTCAAAAGCAAATTATGAAATTAGATAGGCAAATTCAGAGGCTGTTGTTTGC
TTGGATTGATAAACACTTAGAAGGGACTGATAATCCACGCGCCAATGGTAAAGGTTTGACAGGCAATCATGCTAACGAGT
GGCGTTATCGTATCGGAGATTACCGACTGATTTGCGATATTCAAGATGATAAGTTGGTTATTTTAGCACTTGAGTTTGGA
CATCGTAAAGATGTCTATTGA
ATGTATCATTTAGAGTATTCTAAAAAGGCTCAAAAGCAAATTATGAAATTAGATAGGCAAATTCAGAGGCTGTTGTTTGC
TTGGATTGATAAACACTTAGAAGGGACTGATAATCCACGCGCCAATGGTAAAGGTTTGACAGGCAATCATGCTAACGAGT
GGCGTTATCGTATCGGAGATTACCGACTGATTTGCGATATTCAAGATGATAAGTTGGTTATTTTAGCACTTGAGTTTGGA
CATCGTAAAGATGTCTATTGA
Antitoxin
Download Length: 74 a.a. Molecular weight: 8566.55 Da Isoelectric Point: 4.4791
>AT10158 WP_012775256.1 NC_012924:c1439259-1439038 [Streptococcus suis SC84]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL
Download Length: 222 bp
>AT10158 NC_012924:c1439259-1439038 [Streptococcus suis SC84]
ATGAGTACAGTGACAATCAGATTAAATCAAGAAGAAGAAGTATTCTTTAAAAGCTATGCACAATTAACAGGTCAAAGTCT
TTCTAGCCTTTTTAAGAAAGCTTTGGAGCGTGATATTGAAGATGAGTATGATTTAAAAATCTATCATCAAGCTTATGATG
AGTACAAAGCAGATCCAGAAACAATTAGTCATGCTGATTTTAAGAAAGAGCTAGGATTATAG
ATGAGTACAGTGACAATCAGATTAAATCAAGAAGAAGAAGTATTCTTTAAAAGCTATGCACAATTAACAGGTCAAAGTCT
TTCTAGCCTTTTTAAGAAAGCTTTGGAGCGTGATATTGAAGATGAGTATGATTTAAAAATCTATCATCAAGCTTATGATG
AGTACAAAGCAGATCCAGAAACAATTAGTCATGCTGATTTTAAGAAAGAGCTAGGATTATAG
Similar Proteins
Only experimentally validated proteins are listed.
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T10157 | Streptococcus suis SC84 | 51.765 | 98.837 | 0.512 |
T727 | Streptococcus pneumoniae R6 | 45.349 | 100 | 0.464 |
T326 | Streptococcus pneumoniae TIGR4 | 45.349 | 100 | 0.464 |
T10191 | Synechococcus sp. CB0101 | 35.714 | 100 | 0.357 |
T1729 | Acidithiobacillus caldus | 33.721 | 100 | 0.337 |
T124 | Mycobacterium tuberculosis H37Rv | 29.885 | 100 | 0.302 |
T10123 | Paracoccus phage vB_PkoS_Pkon1 | 29.07 | 100 | 0.301 |
Showing 1 to 7 of 7 rows
Multiple sequence alignment
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
AT10157 | Streptococcus suis SC84 | 46.479 | 97.26 | 0.452 |
AT326 | Streptococcus pneumoniae TIGR4 | 33.766 | 100 | 0.356 |
AT727 | Streptococcus pneumoniae R6 | 33.766 | 100 | 0.356 |
Showing 1 to 3 of 3 rows
Multiple sequence alignment
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K1T1M7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z8BIX7 |
References
(1) Jiali Xu et al. (2018) Identification of Three Type II Toxin-Antitoxin Systems in Streptococcus suis Serotype 2. Toxins 10(11):467. [PubMed:30428568]