Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1433979..1434462 Replicon chromosome
Accession NZ_CP102748
Organism Streptococcus suis strain Transconjugant cSFJ45

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag NWE21_RS07085 Protein ID WP_012027435.1
Coordinates 1433979..1434239 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NWE21_RS07090 Protein ID WP_012775256.1
Coordinates 1434241..1434462 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE21_RS07060 (NWE21_07070) 1429364..1430593 - 1230 WP_012775253.1 tetratricopeptide repeat protein -
NWE21_RS07065 (NWE21_07075) 1430583..1431749 - 1167 WP_012775254.1 AI-2E family transporter -
NWE21_RS07070 (NWE21_07080) 1431885..1432889 + 1005 WP_012028380.1 lactonase family protein -
NWE21_RS07075 (NWE21_07085) 1432953..1433138 + 186 WP_002935693.1 hypothetical protein -
NWE21_RS07080 (NWE21_07090) 1433171..1433812 - 642 WP_012775255.1 HAD family hydrolase -
NWE21_RS07085 (NWE21_07095) 1433979..1434239 - 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE21_RS07090 (NWE21_07100) 1434241..1434462 - 222 WP_012775256.1 DUF6290 family protein Antitoxin
NWE21_RS07095 (NWE21_07105) 1434772..1436079 - 1308 WP_002935704.1 phosphopyruvate hydratase -
NWE21_RS07100 (NWE21_07110) 1436229..1436681 + 453 WP_012028381.1 DUF1694 domain-containing protein -
NWE21_RS07105 (NWE21_07115) 1436747..1436917 - 171 WP_014636067.1 hypothetical protein -
NWE21_RS07110 (NWE21_07120) 1436908..1438035 - 1128 WP_012028382.1 glycerate kinase -
NWE21_RS07115 (NWE21_07125) 1438143..1438793 + 651 WP_012027441.1 HAD family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1439230..1440432 1202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T254121 WP_012027435.1 NZ_CP102748:c1434239-1433979 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT254121 WP_012775256.1 NZ_CP102748:c1434462-1434241 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References