Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1349850..1350333 Replicon chromosome
Accession NZ_CP102154
Organism Streptococcus suis strain SS15055_N2_C15

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag NQZ87_RS06575 Protein ID WP_012027435.1
Coordinates 1349850..1350110 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NQZ87_RS06580 Protein ID WP_012775256.1
Coordinates 1350112..1350333 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ87_RS06550 (NQZ87_06550) 1345235..1346464 - 1230 WP_012775253.1 tetratricopeptide repeat protein -
NQZ87_RS06555 (NQZ87_06555) 1346454..1347620 - 1167 WP_012775254.1 AI-2E family transporter -
NQZ87_RS06560 (NQZ87_06560) 1347756..1348760 + 1005 WP_012028380.1 lactonase family protein -
NQZ87_RS06565 (NQZ87_06565) 1348824..1349009 + 186 WP_002935693.1 hypothetical protein -
NQZ87_RS06570 (NQZ87_06570) 1349042..1349683 - 642 WP_012775255.1 HAD family hydrolase -
NQZ87_RS06575 (NQZ87_06575) 1349850..1350110 - 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ87_RS06580 (NQZ87_06580) 1350112..1350333 - 222 WP_012775256.1 DUF6290 family protein Antitoxin
NQZ87_RS06585 (NQZ87_06585) 1350643..1351950 - 1308 WP_002935704.1 phosphopyruvate hydratase -
NQZ87_RS06590 (NQZ87_06590) 1352100..1352552 + 453 WP_012028381.1 DUF1694 domain-containing protein -
NQZ87_RS06595 (NQZ87_06595) 1352618..1352788 - 171 WP_014636067.1 hypothetical protein -
NQZ87_RS06600 (NQZ87_06600) 1352779..1353906 - 1128 WP_012028382.1 glycerate kinase -
NQZ87_RS06605 (NQZ87_06605) 1354014..1354664 + 651 WP_012027441.1 HAD family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1355101..1356303 1202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T253264 WP_012027435.1 NZ_CP102154:c1350110-1349850 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT253264 WP_012775256.1 NZ_CP102154:c1350333-1350112 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References