Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1417097..1417580 Replicon chromosome
Accession NZ_CP102137
Organism Streptococcus suis strain M104300_S20

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag NQZ96_RS06900 Protein ID WP_012027435.1
Coordinates 1417097..1417357 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag NQZ96_RS06905 Protein ID WP_012775256.1
Coordinates 1417359..1417580 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ96_RS06875 (NQZ96_06875) 1412482..1413711 - 1230 WP_012775253.1 tetratricopeptide repeat protein -
NQZ96_RS06880 (NQZ96_06880) 1413701..1414867 - 1167 WP_012775254.1 AI-2E family transporter -
NQZ96_RS06885 (NQZ96_06885) 1415003..1416007 + 1005 WP_012028380.1 lactonase family protein -
NQZ96_RS06890 (NQZ96_06890) 1416071..1416256 + 186 WP_002935693.1 hypothetical protein -
NQZ96_RS06895 (NQZ96_06895) 1416289..1416930 - 642 WP_012775255.1 HAD family hydrolase -
NQZ96_RS06900 (NQZ96_06900) 1417097..1417357 - 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NQZ96_RS06905 (NQZ96_06905) 1417359..1417580 - 222 WP_012775256.1 DUF6290 family protein Antitoxin
NQZ96_RS06910 (NQZ96_06910) 1417976..1419283 - 1308 WP_002935704.1 phosphopyruvate hydratase -
NQZ96_RS06915 (NQZ96_06915) 1419433..1419885 + 453 WP_012028381.1 DUF1694 domain-containing protein -
NQZ96_RS06920 (NQZ96_06920) 1419951..1420121 - 171 WP_014636067.1 hypothetical protein -
NQZ96_RS06925 (NQZ96_06925) 1420112..1421239 - 1128 WP_012028382.1 glycerate kinase -
NQZ96_RS06930 (NQZ96_06930) 1421347..1421997 + 651 WP_012027441.1 HAD family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1422434..1423636 1202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T253213 WP_012027435.1 NZ_CP102137:c1417357-1417097 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT253213 WP_012775256.1 NZ_CP102137:c1417580-1417359 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References