Detailed information NTG0909044

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: SM130_RS16995
• Genome accession: NZ_CP139348
• Coordinates: 3691815..3692000 (+)
• Length: 61 a.a.
• NCBI ID: WP_102824888.1
• Uniprot ID: A0A2N8S1P9
• Organism: Stutzerimonas stutzeri strain KC
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3686815..3697000

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SM130_RS16975 (SM130_16975)	coaE	3686890..3687498 (-)	609	WP_102824892.1	dephospho-CoA kinase	-
SM130_RS16980 (SM130_16980)	pilD	3687650..3688519 (-)	870	WP_102824891.1	A24 family peptidase	Machinery gene
SM130_RS16985 (SM130_16985)	pilC	3688520..3689740 (-)	1221	WP_102824890.1	type II secretion system F family protein	Machinery gene
SM130_RS16990 (SM130_16990)	pilB	3689743..3691446 (-)	1704	WP_102824889.1	type IV-A pilus assembly ATPase PilB	Machinery gene
SM130_RS16995 (SM130_16995)	pilA	3691815..3692000 (+)	186	WP_102824888.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
SM130_RS17000 (SM130_17000)	-	3692015..3692461 (+)	447	WP_146029737.1	hypothetical protein	-
SM130_RS17005 (SM130_17005)	-	3692532..3692711 (+)	180	WP_102824887.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
SM130_RS17010 (SM130_17010)	-	3693109..3693918 (+)	810	WP_219725296.1	hypothetical protein	-
SM130_RS17015 (SM130_17015)	-	3693920..3694756 (+)	837	WP_181019250.1	hypothetical protein	-
SM130_RS17020 (SM130_17020)	-	3694753..3695649 (+)	897	WP_102824886.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6594.84 Da
• Isoelectric Point: 10.2806

>NTDB_id=909044 SM130_RS16995 WP_102824888.1 3691815..3692000(+) (pilA) [Stutzerimonas stutzeri strain KC]
MKSIKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRSKSNDTVANADAKNTLTVMSAAQL

Nucleotide

• Length: 186 bp

>NTDB_id=909044 SM130_RS16995 WP_102824888.1 3691815..3692000(+) (pilA) [Stutzerimonas stutzeri strain KC]
ATGAAGTCCATCAAGAAGCAAAAAGGTTTTACCCTGATTGAGCTGATGATCGTGGTTGCGATCATTGGCATTCTGGCTGC
CATCGCGATTCCGCAGTTCAATGAGTACCGCTCTAAGTCGAACGATACCGTAGCCAACGCGGACGCGAAAAACACCCTTA
CCGTTATGTCTGCCGCACAGCTCTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

3D structure

• AlphaFold DB: A0A2N8S1P9

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	60.784	83.607	0.508
pilA	Vibrio parahaemolyticus RIMD 2210633	60	81.967	0.492
pilA	Ralstonia pseudosolanacearum GMI1000	60.417	78.689	0.475
pilA	Pseudomonas aeruginosa PAK	76.316	62.295	0.475
pilA	Acinetobacter baumannii strain A118	85.294	55.738	0.475
pilA2	Legionella pneumophila str. Paris	63.043	75.41	0.475
pilA2	Legionella pneumophila strain ERS1305867	63.043	75.41	0.475
pilA	Vibrio cholerae strain A1552	77.778	59.016	0.459
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	77.778	59.016	0.459
pilA	Vibrio cholerae C6706	77.778	59.016	0.459
pilA	Acinetobacter nosocomialis M2	82.353	55.738	0.459
pilA/pilAI	Pseudomonas stutzeri DSM 10701	77.143	57.377	0.443
pilA	Vibrio campbellii strain DS40M4	75	59.016	0.443
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	49.057	86.885	0.426
pilA/pilAII	Pseudomonas stutzeri DSM 10701	63.415	67.213	0.426
pilA/pilA1	Eikenella corrodens VA1	66.667	63.934	0.426
pilA/pilA4	Thermus thermophilus HB27	56.818	72.131	0.41
comF	Acinetobacter baylyi ADP1	63.158	62.295	0.393
pilA/pilA1	Synechocystis sp. PCC 6803	42.857	91.803	0.393
pilE	Acinetobacter baumannii D1279779	53.333	73.77	0.393
pilE	Legionella pneumophila strain ERS1305867	46.939	80.328	0.377
pilE	Legionella pneumophila str. Paris	46.939	80.328	0.377
pilA	Haemophilus influenzae Rd KW20	67.647	55.738	0.377
pilA	Haemophilus influenzae 86-028NP	67.647	55.738	0.377
comE	Acinetobacter baylyi ADP1	62.162	60.656	0.377
fimU	Acinetobacter baumannii D1279779	36.066	100	0.361
pilA	Glaesserella parasuis strain SC1401	66.667	54.098	0.361
pilX	Neisseria meningitidis 8013	64.706	55.738	0.361
pilE	Neisseria gonorrhoeae MS11	64.706	55.738	0.361
pilE	Neisseria gonorrhoeae strain FA1090	64.706	55.738	0.361
pilL	Neisseria gonorrhoeae MS11	62.857	57.377	0.361