Detailed information NTG0001274

Experimentally validated

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: LPP_RS09530
• Genome accession: NC_006368
• Coordinates: 2137882..2138292 (-)
• Length: 136 a.a.
• NCBI ID: WP_011214168.1
• Uniprot ID: A0AAX2J0V3
• Organism: Legionella pneumophila str. Paris
• Function: assembly of type IV pilus DNA binding and uptake

Function

Both the Tn-seq data and reconstructed mutants show that PilA2 is required for natural transformation, while PilA1 is dispensable.

Genomic Context

Location: 2132882..2143292

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LPP_RS09515 (lpp1887)	letS	2133204..2135936 (+)	2733	WP_011214165.1	two-component system sensor histidine kinase LetS	Regulator
LPP_RS09520 (lpp1888)	-	2136034..2137278 (+)	1245	WP_011214166.1	6-phosphofructokinase	-
LPP_RS09525 (lpp1889)	pilA2	2137275..2137688 (-)	414	WP_011214167.1	pilin	Machinery gene
LPP_RS09530 (lpp1890)	pilA2	2137882..2138292 (-)	411	WP_011214168.1	pilin	Machinery gene
LPP_RS09535 (lpp1891)	-	2138595..2138912 (+)	318	WP_011214169.1	BolA family protein	-
LPP_RS09540 (lpp1892)	-	2138987..2140408 (+)	1422	WP_011214170.1	APC family permease	-
LPP_RS09545 (lpp1893)	-	2140514..2141944 (-)	1431	WP_011214171.1	cellulase family glycosylhydrolase	-
LPP_RS09550 (lpp1894)	kdsB	2142192..2142944 (-)	753	WP_011214172.1	3-deoxy-manno-octulosonate cytidylyltransferase	-
LPP_RS09555 (lpp1895)	-	2142941..2143120 (-)	180	WP_010947637.1	Trm112 family protein	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 13854.07 Da
• Isoelectric Point: 8.4715

>NTDB_id=1274 LPP_RS09530 WP_011214168.1 2137882..2138292(-) (pilA2) [Legionella pneumophila str. Paris]
MRQKGFTLIELMIVVAIIGILAAIAIPAYQDYTIRARVTEGLTLADSAKLAVSETAITNNALPATQAATGYVSPAATPNV
ASIAIGANGVITITYTAAAGGGTIVMTPTLQANGDVTWTCTGGTLLAKYRPASCRP

Nucleotide

• Length: 411 bp

>NTDB_id=1274 LPP_RS09530 WP_011214168.1 2137882..2138292(-) (pilA2) [Legionella pneumophila str. Paris]
ATGAGACAAAAGGGTTTTACTTTAATTGAATTGATGATAGTCGTAGCGATTATCGGTATTTTGGCAGCAATCGCTATACC
AGCCTATCAAGATTACACAATACGAGCTCGTGTTACTGAGGGTCTGACCTTGGCAGATTCTGCAAAACTTGCCGTGTCTG
AAACGGCTATTACAAACAACGCGTTACCAGCTACTCAGGCTGCAACGGGCTATGTGTCTCCTGCTGCTACGCCCAATGTG
GCATCAATTGCTATTGGTGCGAACGGTGTGATTACCATCACGTATACTGCTGCAGCAGGTGGAGGTACCATAGTTATGAC
CCCAACCTTACAAGCTAACGGTGATGTAACCTGGACTTGTACGGGTGGTACTTTGTTGGCTAAATATCGACCTGCCAGCT
GCAGACCATAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-135)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	98.529	100	0.985
pilA	Ralstonia pseudosolanacearum GMI1000	49.689	100	0.588
comP	Acinetobacter baylyi ADP1	53.793	100	0.574
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	37.566	100	0.522
pilA/pilA1	Eikenella corrodens VA1	39.873	100	0.463
pilA	Haemophilus influenzae 86-028NP	40.816	100	0.441
pilE	Neisseria gonorrhoeae strain FA1090	36.943	100	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.963	99.265	0.426
pilA	Acinetobacter baumannii strain A118	39.726	100	0.426
pilA	Pseudomonas aeruginosa PAK	39.189	100	0.426
pilE	Neisseria gonorrhoeae MS11	37.179	100	0.426
pilA	Vibrio campbellii strain DS40M4	48.485	85.714	0.416
pilA	Haemophilus influenzae Rd KW20	44.094	93.382	0.412
pilA	Vibrio cholerae strain A1552	38.462	100	0.404
pilA	Vibrio cholerae C6706	38.462	100	0.404
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	38.462	100	0.404
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.855	100	0.404
pilA	Glaesserella parasuis strain SC1401	37.5	100	0.375
pilA	Vibrio parahaemolyticus RIMD 2210633	38.462	95.588	0.368

References

• [1]: Léo Hardy et al. (2021) Transposon Insertion Sequencing in a Clinical Isolate of Legionella pneumophila Identifies Essential Genes and Determinants of Natural Transformation. Journal of Bacteriology 203(3):e00548-20. [PMID: 33168636]