Detailed information NTG0001002

Experimentally validated

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: ACIAD_RS15100
• Genome accession: NC_005966
• Coordinates: 3240883..3241326 (-)
• Length: 147 a.a.
• NCBI ID: WP_004923779.1
• Uniprot ID: A0A7G2SAY1
• Organism: Acinetobacter baylyi ADP1
• Function: assembly of type IV pilus DNA binding and uptake

Function

The seven competence proteins, ComB, ComP, PilV, PilX and FimT are absolutely essential for natural transformation. These proteins are hydrophilic and are similar to pilins, the structural subunits of type IV pili (T4P). The disruption of comB, comP and the deletion of pilV, pilX or fimT resulted in complete transformation deficiencies. DNA binding and uptake studies with comP-mutants revealed that ComP is absolutely essential for DNA binding and/or uptake.

Genomic Context

Location: 3235883..3246326

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACIAD_RS15085 (ACIAD3335)	-	3237618..3238340 (-)	723	WP_004923789.1	fimbrial biogenesis chaperone	-
ACIAD_RS15090 (ACIAD3336)	-	3238386..3238838 (-)	453	WP_004923785.1	Csu type fimbrial protein	-
ACIAD_RS15095 (ACIAD3337)	pglL2	3239175..3240821 (-)	1647	WP_004923783.1	ComP-specific O-oligosaccharyltransferase PglL2	-
ACIAD_RS15100 (ACIAD3338)	comP	3240883..3241326 (-)	444	WP_004923779.1	pilin	Machinery gene
ACIAD_RS15105 (ACIAD3339)	adhP	3241694..3242725 (-)	1032	WP_004923772.1	alcohol dehydrogenase AdhP	-
ACIAD_RS15110 (ACIAD3340)	-	3243530..3244393 (+)	864	WP_004923768.1	carbon-nitrogen hydrolase family protein	-

Sequence

Protein

• Length: 147 a.a.
• Molecular weight: 14872.03 Da
• Isoelectric Point: 8.1036

>NTDB_id=1002 ACIAD_RS15100 WP_004923779.1 3240883..3241326(-) (comP) [Acinetobacter baylyi ADP1]
MNAQKGFTLIELMIVIAIIGILAAIAIPAYTDYTVRARVSEGLTAASSMKTTVSENILNAGALVAGTPSTAGSSCVGVQE
ISASNATTNVATATCGASSAGQIIVTMDTTKAKGANITLTPTYASGAVTWKCTTTSDKKYVPSECRG

Nucleotide

• Length: 444 bp

>NTDB_id=1002 ACIAD_RS15100 WP_004923779.1 3240883..3241326(-) (comP) [Acinetobacter baylyi ADP1]
ATGAATGCACAAAAGGGTTTTACCTTAATTGAATTGATGATTGTCATTGCGATCATTGGTATTTTGGCAGCGATTGCGAT
TCCTGCTTATACAGATTATACAGTCCGTGCACGTGTTTCTGAAGGATTAACAGCAGCATCATCCATGAAAACGACGGTTT
CAGAAAATATTTTAAATGCAGGTGCATTAGTTGCAGGTACTCCTTCAACTGCAGGCTCATCTTGCGTTGGAGTCCAAGAA
ATTTCAGCAAGTAATGCCACTACGAACGTAGCAACTGCTACATGTGGAGCGAGTAGTGCTGGACAAATCATTGTAACTAT
GGATACTACTAAGGCTAAGGGCGCTAATATAACATTAACGCCAACATATGCTAGTGGCGCTGTAACATGGAAATGTACGA
CAACTTCTGATAAAAAATATGTACCATCAGAATGTCGTGGTTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-26)

• Pilin (bacterial filament) (Pilin) (35-146)

3D structure

• AlphaFold DB: A0A7G2SAY1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	53.793	100	0.574
pilA2	Legionella pneumophila strain ERS1305867	53.103	100	0.566
pilA	Ralstonia pseudosolanacearum GMI1000	44.444	100	0.517
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	38.587	100	0.483
pilA/pilAI	Pseudomonas stutzeri DSM 10701	43.448	100	0.453
pilE	Neisseria gonorrhoeae MS11	39.286	100	0.449
pilA	Pseudomonas aeruginosa PAK	40.789	100	0.422
pilA/pilA1	Eikenella corrodens VA1	38.462	100	0.408
pilA/pilAII	Pseudomonas stutzeri DSM 10701	39.583	100	0.404
pilE	Neisseria gonorrhoeae strain FA1090	36.42	100	0.401
pilA	Acinetobacter baumannii strain A118	40	98.639	0.395
pilA	Vibrio campbellii strain DS40M4	41.912	92.517	0.388
pilA	Acinetobacter nosocomialis M2	40	91.837	0.367
pilA	Vibrio cholerae C6706	37.063	97.279	0.361
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.063	97.279	0.361
pilA	Vibrio cholerae strain A1552	37.063	97.279	0.361

References

• [1]: Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714]
• [2]: Colleen G Leong et al. (2017) The role of core and accessory type IV pilus genes in natural transformation and twitching motility in the bacterium Acinetobacter baylyi. PloS One 12(8):e0182139. [PMID: 28771515]
• [3]: D Porstendörfer et al. (2000) ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. Strain BD413: regulation, modification, and cellular localization. Journal of Bacteriology 182(13):3673-80. [PMID: 10850981]
• [4]: D Porstendörfer et al. (1997) A novel competence gene, comP, is essential for natural transformation of Acinetobacter sp. strain BD413. Applied And Environmental Microbiology 63(11):4150-7. [PMID: 9361398]