Detailed information
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | ACIAD_RS15100 | Genome accession | NC_005966 |
| Coordinates | 3240883..3241326 (-) | Length | 147 a.a. |
| NCBI ID | WP_004923779.1 | Uniprot ID | O30583 |
| Organism | Acinetobacter baylyi ADP1 | ||
| Function | assembly of type IV pilus DNA binding and uptake |
||
Function
The seven competence proteins, ComB, ComP, PilV, PilX and FimT are absolutely essential for natural transformation. These proteins are hydrophilic and are similar to pilins, the structural subunits of type IV pili (T4P). The disruption of comB, comP and the deletion of pilV, pilX or fimT resulted in complete transformation deficiencies. DNA binding and uptake studies with comP-mutants revealed that ComP is absolutely essential for DNA binding and/or uptake.
Genomic Context
Location: 3235883..3246326
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACIAD_RS15085 (ACIAD3335) | - | 3237618..3238340 (-) | 723 | WP_004923789.1 | fimbrial biogenesis chaperone | - |
| ACIAD_RS15090 (ACIAD3336) | - | 3238386..3238838 (-) | 453 | WP_004923785.1 | Csu type fimbrial protein | - |
| ACIAD_RS15095 (ACIAD3337) | pglL2 | 3239175..3240821 (-) | 1647 | WP_004923783.1 | ComP-specific O-oligosaccharyltransferase PglL2 | - |
| ACIAD_RS15100 (ACIAD3338) | comP | 3240883..3241326 (-) | 444 | WP_004923779.1 | pilin | Machinery gene |
| ACIAD_RS15105 (ACIAD3339) | adhP | 3241694..3242725 (-) | 1032 | WP_004923772.1 | alcohol dehydrogenase AdhP | - |
| ACIAD_RS15110 (ACIAD3340) | - | 3243530..3244393 (+) | 864 | WP_004923768.1 | carbon-nitrogen hydrolase family protein | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 14872.03 Da Isoelectric Point: 8.1036
MNAQKGFTLIELMIVIAIIGILAAIAIPAYTDYTVRARVSEGLTAASSMKTTVSENILNAGALVAGTPSTAGSSCVGVQE
ISASNATTNVATATCGASSAGQIIVTMDTTKAKGANITLTPTYASGAVTWKCTTTSDKKYVPSECRG
Nucleotide
Download Length: 444 bp
ATGAATGCACAAAAGGGTTTTACCTTAATTGAATTGATGATTGTCATTGCGATCATTGGTATTTTGGCAGCGATTGCGAT
TCCTGCTTATACAGATTATACAGTCCGTGCACGTGTTTCTGAAGGATTAACAGCAGCATCATCCATGAAAACGACGGTTT
CAGAAAATATTTTAAATGCAGGTGCATTAGTTGCAGGTACTCCTTCAACTGCAGGCTCATCTTGCGTTGGAGTCCAAGAA
ATTTCAGCAAGTAATGCCACTACGAACGTAGCAACTGCTACATGTGGAGCGAGTAGTGCTGGACAAATCATTGTAACTAT
GGATACTACTAAGGCTAAGGGCGCTAATATAACATTAACGCCAACATATGCTAGTGGCGCTGTAACATGGAAATGTACGA
CAACTTCTGATAAAAAATATGTACCATCAGAATGTCGTGGTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA2 | Legionella pneumophila str. Paris |
53.793 |
100 |
0.574 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
53.103 |
100 |
0.566 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
44.444 |
100 |
0.517 |
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
38.587 |
100 |
0.483 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
43.448 |
100 |
0.453 |
| pilE | Neisseria gonorrhoeae MS11 |
39.286 |
100 |
0.449 |
| pilA | Pseudomonas aeruginosa PAK |
40.789 |
100 |
0.422 |
| pilA/pilA1 | Eikenella corrodens VA1 |
38.462 |
100 |
0.408 |
| pilA/pilAII | Pseudomonas stutzeri DSM 10701 |
39.583 |
100 |
0.404 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
36.42 |
100 |
0.401 |
| pilA | Acinetobacter baumannii strain A118 |
40 |
98.639 |
0.395 |
| pilA | Vibrio campbellii strain DS40M4 |
41.912 |
92.517 |
0.388 |
| pilA | Acinetobacter nosocomialis M2 |
40 |
91.837 |
0.367 |
| pilA | Vibrio cholerae C6706 |
37.063 |
97.279 |
0.361 |
| pilA | Vibrio cholerae O1 biovar El Tor strain E7946 |
37.063 |
97.279 |
0.361 |
| pilA | Vibrio cholerae strain A1552 |
37.063 |
97.279 |
0.361 |
Multiple sequence alignment
References
| [1] | Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714] |
| [2] | Colleen G Leong et al. (2017) The role of core and accessory type IV pilus genes in natural transformation and twitching motility in the bacterium Acinetobacter baylyi. PloS One 12(8):e0182139. [PMID: 28771515] |
| [3] | D Porstendörfer et al. (2000) ComP, a pilin-like protein essential for natural competence in Acinetobacter sp. Strain BD413: regulation, modification, and cellular localization. Journal of Bacteriology 182(13):3673-80. [PMID: 10850981] |
| [4] | D Porstendörfer et al. (1997) A novel competence gene, comP, is essential for natural transformation of Acinetobacter sp. strain BD413. Applied And Environmental Microbiology 63(11):4150-7. [PMID: 9361398] |