Detailed information NTG0001204

Experimentally validated

Overview

• Name: pilA/pilAII
• Type: Regulator
• Locus tag: PSJM300_03935
• Genome accession: CP003725
• Coordinates: 872331..872756 (-)
• Length: 141 a.a.
• NCBI ID: AFN76865.1
• Uniprot ID: -
• Organism: Pseudomonas stutzeri DSM 10701
• Function: repress natural transformation Competence regulation

Function

Insertional inactivation of pilAII produced a hypertransformation phenotype giving about 16-fold-increased transformation frequencies. The overexpression of pilAII decreased transformation up to 5,000-fold compared to that of the pilAII mutant. It is concluded that PilAII suppresses a step in transformation after the uptake of duplex DNA into the cell and perhaps before its translocation into the cytoplasm.

Genomic Context

Location: 867331..877756

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PSJM300_03915	-	867449..869347 (+)	1899	AFN76861.1	bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein	-
PSJM300_03920	-	869533..869973 (-)	441	AFN76862.1	hypothetical protein	-
PSJM300_03925	-	870169..870918 (-)	750	AFN76863.1	type IV pilin accessory protein	-
PSJM300_03930	-	870915..872306 (-)	1392	AFN76864.1	pilus biogenesis protein	-
PSJM300_03935	pilA/pilAII	872331..872756 (-)	426	AFN76865.1	fimbrial protein pilin: general secretion pathway protein H	Regulator
PSJM300_03940	pilA/pilAI	872824..873243 (-)	420	AFN76866.1	fimbrial protein pilin: general secretion pathway protein H	Machinery gene
PSJM300_03945	pilB	873564..875267 (+)	1704	AFN76867.1	type 4 fimbrial biogenesis protein PilB	Machinery gene
PSJM300_03950	pilC	875269..876486 (+)	1218	AFN76868.1	type 4 pilus biogenesis protein PilC	Machinery gene
PSJM300_03955	pilD	876489..877358 (+)	870	AFN76869.1	type 4 prepilin peptidase PilD	Machinery gene

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 14765.06 Da
• Isoelectric Point: 8.0109

>NTDB_id=1204 PSJM300_03935 AFN76865.1 872331..872756(-) (pilA/pilAII) [Pseudomonas stutzeri DSM 10701]
MKPVKSSCRGFSLIELMIVVAIIGILAAIALPAYQNYTVRSTAASALAEITPAKAAFEQAISEGHTPSLVSSLPGFIGIG
ASTNYCTVTLIATATGSITCTTQNGMPDRFNGKTITIARTTDGLWDCTSDLDSRYKPGKCL

Nucleotide

• Length: 426 bp

>NTDB_id=1204 PSJM300_03935 AFN76865.1 872331..872756(-) (pilA/pilAII) [Pseudomonas stutzeri DSM 10701]
ATGAAGCCCGTGAAATCTTCGTGCCGCGGATTTTCCCTGATCGAGTTGATGATCGTCGTAGCCATCATCGGCATTCTCGC
GGCCATCGCGCTTCCGGCCTATCAGAACTACACCGTGCGTTCGACAGCCGCTTCCGCCTTGGCCGAAATCACACCAGCAA
AGGCCGCGTTTGAGCAAGCCATCAGCGAAGGCCATACCCCTTCACTTGTTTCCAGCCTACCGGGGTTTATCGGCATCGGC
GCAAGCACTAATTATTGCACAGTGACGCTCATTGCCACGGCAACGGGATCGATCACCTGCACCACCCAGAACGGCATGCC
AGATCGGTTCAACGGAAAAACCATCACCATTGCCCGCACGACAGATGGCTTGTGGGACTGCACCAGTGATCTCGACAGCC
GATATAAGCCGGGGAAATGCCTCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-31)

• Pilin (bacterial filament) (Pilin) (39-140)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA/pilAI	Pseudomonas stutzeri DSM 10701	67.424	94.964	0.64
pilA	Pseudomonas aeruginosa PAK	46.575	100	0.482
pilA	Acinetobacter baumannii strain A118	43.796	97.163	0.426
pilA2	Legionella pneumophila str. Paris	39.855	100	0.404
pilA2	Legionella pneumophila strain ERS1305867	39.855	100	0.404
comP	Acinetobacter baylyi ADP1	39.583	100	0.404
pilA	Vibrio cholerae strain A1552	36.986	100	0.383
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	36.986	100	0.383
pilA	Vibrio cholerae C6706	36.986	100	0.383

References

• [1]: S Graupner et al. (2001) Pseudomonas stutzeri has two closely related pilA genes (Type IV pilus structural protein) with opposite influences on natural genetic transformation. Journal of Bacteriology 183(7):2359-66. [PMID: 11244078]