Detailed information NTG0001365

Experimentally validated

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: NTHI_RS01955
• Genome accession: NC_007146
• Coordinates: 396415..396864 (-)
• Length: 149 a.a.
• NCBI ID: WP_011271973.1
• Uniprot ID: Q4QNP4
• Organism: Haemophilus influenzae 86-028NP
• Function: type IV pilus biogenesis and function DNA binding and uptake

Function

The pilABCD and comABCDEF gene clusters are operons and that the product of each gene is essential for normal pilus function. Mutants with nonpolar deletions in each of the 10 pil and com genes had an adherence defect when primary human airway cells were used as the target. These mutants were also diminished in their ability to form a biofilm in vitro and, additionally, were deficient in natural transformation.

Genomic Context

Location: 391415..401864

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NTHI_RS01935 (NTHI0405)	rho	391802..393064 (+)	1263	WP_005648966.1	transcription termination factor Rho	-
NTHI_RS01940 (NTHI0406)	pilD	393118..393810 (-)	693	WP_011271970.1	prepilin peptidase	Machinery gene
NTHI_RS01945 (NTHI0407)	pilC	393807..395027 (-)	1221	WP_011271971.1	type II secretion system F family protein	Machinery gene
NTHI_RS01950 (NTHI0408)	pilB	395024..396418 (-)	1395	WP_011271972.1	GspE/PulE family protein	Machinery gene
NTHI_RS01955 (NTHI0409)	pilA	396415..396864 (-)	450	WP_011271973.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
NTHI_RS01960 (NTHI0411)	ampD	396979..397539 (+)	561	WP_011271974.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
NTHI_RS01965 (NTHI0412)	corC	398161..399060 (+)	900	WP_005656283.1	CNNM family magnesium/cobalt transport protein CorC	-
NTHI_RS01970 (NTHI0413)	lnt	399083..400612 (+)	1530	WP_079989936.1	apolipoprotein N-acyltransferase	-
NTHI_RS01975 (NTHI0414)	rsmE	400662..401399 (+)	738	WP_011271976.1	16S rRNA (uracil(1498)-N(3))-methyltransferase	-

Sequence

Protein

• Length: 149 a.a.
• Molecular weight: 15572.89 Da
• Isoelectric Point: 8.0922

>NTDB_id=1365 NTHI_RS01955 WP_011271973.1 396415..396864(-) (pilA) [Haemophilus influenzae 86-028NP]
MKLTTQQTLKKGFTLIELMIVIAIIAILATIAIPSYQNYTKKAAVSELLQASAPYKADVELCVYSTNETTNCTGGKNGIA
ADITTAKGYVKSVTTSNGAITVKGDGTLANMEYILQATGNAATGVTWTTTCKGTDASLFPANFCGSVTQ

Nucleotide

• Length: 450 bp

>NTDB_id=1365 NTHI_RS01955 WP_011271973.1 396415..396864(-) (pilA) [Haemophilus influenzae 86-028NP]
ATGAAACTAACAACACAGCAAACCTTGAAAAAAGGGTTTACATTAATAGAGCTAATGATTGTGATTGCAATTATTGCTAT
TTTAGCCACTATCGCAATTCCCTCTTATCAAAATTATACTAAAAAAGCAGCGGTATCTGAATTACTGCAAGCGTCAGCGC
CTTATAAGGCTGATGTGGAATTATGTGTATATAGCACAAATGAAACAACAAACTGTACGGGTGGAAAAAATGGTATTGCA
GCAGATATAACCACAGCAAAAGGCTATGTAAAATCAGTGACAACAAGCAACGGTGCAATAACAGTAAAAGGGGATGGCAC
ATTGGCAAATATGGAATATATTTTGCAAGCTACAGGTAATGCTGCAACAGGTGTAACTTGGACAACAACTTGCAAAGGAA
CGGATGCCTCTTTATTTCCAGCAAATTTTTGCGGAAGTGTCACACAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-32)

3D structure

• AlphaFold DB: Q4QNP4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Haemophilus influenzae Rd KW20	91.946	100	0.919
pilA	Glaesserella parasuis strain SC1401	54.362	100	0.544
pilA2	Legionella pneumophila str. Paris	40.816	100	0.441
pilA2	Legionella pneumophila strain ERS1305867	40.816	100	0.441
pilA	Vibrio campbellii strain DS40M4	41.844	91.558	0.383

References

• [1]: Michael D Carruthers et al. (2012) Biological roles of nontypeable Haemophilus influenzae type IV pilus proteins encoded by the pil and com operons. Journal of Bacteriology 194(8):1927-33. [PMID: 22328674]