Detailed information
Overview
| Name | fimU | Type | Machinery gene |
| Locus tag | ABD1_RS15750 | Genome accession | NC_020547 |
| Coordinates | 3326017..3326490 (-) | Length | 157 a.a. |
| NCBI ID | WP_001214065.1 | Uniprot ID | N9K1Q3 |
| Organism | Acinetobacter baumannii D1279779 | ||
| Function | assembly of type IV pilus DNA binding and uptake |
||
Function
We examined the 33 knockout mutants by comparing their transformation efficiency with wild-type W068. No knockout strains were affected in growth, but 28 of these mutants were severely or completely impaired in natural transformability. These mutations were in 18 genes related to T4P (pilF, pilQ, tsaP, pilM, pilN, pilO, pilP, pilB, pilC, pilT, pilD, pilE, pilY2, pilY1, pilX, pilW, pilV, and fimU), six genes related to DNA uptake and processing (comEA, comA, comF, priA, dprA, and recA), two genes related to T2SS (xcpV and xcpW), and the crp and tonB2 genes.
Genomic Context
Location: 3321017..3331490
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABD1_RS15735 (ABD1_30530) | pilX | 3323646..3324464 (-) | 819 | WP_000149372.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| ABD1_RS15740 (ABD1_30540) | pilW | 3324461..3325462 (-) | 1002 | WP_000079197.1 | PilW family protein | Machinery gene |
| ABD1_RS15745 (ABD1_30550) | pilV | 3325463..3326023 (-) | 561 | WP_002194578.1 | type IV pilus modification protein PilV | Machinery gene |
| ABD1_RS15750 (ABD1_30560) | fimU | 3326017..3326490 (-) | 474 | WP_001214065.1 | pilus assembly FimT family protein | Machinery gene |
| ABD1_RS15755 (ABD1_30570) | ispH | 3326660..3327610 (-) | 951 | WP_000407064.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| ABD1_RS15760 (ABD1_30580) | gmk | 3327733..3328362 (+) | 630 | WP_000015937.1 | guanylate kinase | - |
| ABD1_RS15765 (ABD1_30590) | rpoZ | 3328435..3328713 (+) | 279 | WP_000135049.1 | DNA-directed RNA polymerase subunit omega | - |
| ABD1_RS18215 | - | 3328752..3328882 (+) | 131 | Protein_3129 | hypothetical protein | - |
| ABD1_RS15770 (ABD1_30600) | - | 3328922..3331027 (+) | 2106 | WP_001117592.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 16837.43 Da Isoelectric Point: 8.5355
MRGIIPQEGFTLVELMVTIAVMAIIALMAAPSMSNLLESKRLDANQRDLINTLSEAKSQAILGRQNVSVNLNSTASNTPT
SLNWQTASNNTLELKNIAADGTQSSLTTTTLAFNANGVVANITQDTLLSICNSRINKKKVIILTKLGTLVFKAEETC
Nucleotide
Download Length: 474 bp
ATGAGGGGAATTATTCCACAAGAAGGGTTCACCTTGGTCGAGCTAATGGTGACGATTGCGGTCATGGCTATTATTGCATT
GATGGCTGCGCCATCAATGTCAAATTTATTAGAAAGTAAACGTTTAGATGCTAATCAAAGAGACTTAATCAACACTTTAT
CAGAAGCGAAAAGTCAGGCAATTTTAGGCCGTCAGAATGTTTCTGTTAACTTGAACTCAACAGCTTCAAATACACCCACT
TCATTAAATTGGCAGACAGCTTCTAATAATACTCTTGAGCTAAAAAATATAGCCGCTGATGGTACGCAAAGTTCTTTAAC
GACTACCACTTTAGCTTTTAATGCAAATGGAGTAGTGGCAAATATAACTCAAGATACGCTTTTATCTATTTGTAATTCTA
GAATAAATAAAAAGAAAGTCATTATTTTGACCAAGCTTGGCACTTTAGTTTTTAAGGCCGAGGAGACTTGTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Yuan Hu et al. (2021) Natural Transformation in Acinetobacter baumannii W068: A Genetic Analysis Reveals the Involvements of the CRP, XcpV, XcpW, TsaP, and TonB2. Frontiers in Microbiology 12:738034. [PMID: 35126321] |