Detailed information NTG0001006

Experimentally validated

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: ACIAD_RS15005
• Genome accession: NC_005966
• Coordinates: 3219769..3220278 (-)
• Length: 169 a.a.
• NCBI ID: WP_004923843.1
• Uniprot ID: Q9X2M4
• Organism: Acinetobacter baylyi ADP1
• Function: assembly of type IV pilus DNA binding and uptake

Function

Disruption of comE and comF led to only 10- to 1000-fold reduced transformation frequencies. ComE and ComF are accessory factors of minor importance for the pilus-like structure involved in DNA uptake.

Genomic Context

Location: 3214769..3225278

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACIAD_RS14970 (ACIAD3308)	-	3214851..3215882 (+)	1032	WP_004923856.1	lipase secretion chaperone	-
ACIAD_RS14975 (ACIAD3309)	-	3216014..3216982 (+)	969	WP_004923853.1	esterase/lipase family protein	-
ACIAD_RS14980 (ACIAD3310)	rplS	3217052..3217423 (-)	372	WP_004923849.1	50S ribosomal protein L19	-
ACIAD_RS14985 (ACIAD3311)	trmD	3217565..3218314 (-)	750	WP_004923847.1	tRNA (guanosine(37)-N1)-methyltransferase TrmD	-
ACIAD_RS14990 (ACIAD3312)	rimM	3218362..3218910 (-)	549	WP_004923846.1	ribosome maturation factor RimM	-
ACIAD_RS14995 (ACIAD3313)	rpsP	3218930..3219187 (-)	258	WP_004923845.1	30S ribosomal protein S16	-
ACIAD_RS15000 (ACIAD3314)	comF	3219335..3219769 (-)	435	WP_004923844.1	type IV pilin protein	Machinery gene
ACIAD_RS15005 (ACIAD3315)	comE	3219769..3220278 (-)	510	WP_004923843.1	type IV pilin protein	Machinery gene
ACIAD_RS15010 (ACIAD3316)	comC	3220340..3224692 (-)	4353	WP_004923840.1	PilC/PilY family type IV pilus protein	Machinery gene

Sequence

Protein

• Length: 169 a.a.
• Molecular weight: 18882.38 Da
• Isoelectric Point: 8.9118

>NTDB_id=1006 ACIAD_RS15005 WP_004923843.1 3219769..3220278(-) (comE) [Acinetobacter baylyi ADP1]
MQHHRQGFTLIELMVVVVIIAIFAAIAIPSYQEYIRRSNLAMAQQEMQKLAEQLERYRSRNFSYKGFDATYLYQDKSGQT
LAKFDSTKQIVQLPLDTSNTKYTLAVVDTTTNNPLLTSANAIGQGWAIKAMSADNNNYSLLLTNTGFSCKNKTWANISSS
SCGTGSESW

Nucleotide

• Length: 510 bp

>NTDB_id=1006 ACIAD_RS15005 WP_004923843.1 3219769..3220278(-) (comE) [Acinetobacter baylyi ADP1]
ATGCAGCATCACAGACAGGGTTTTACGCTGATTGAATTGATGGTCGTAGTTGTGATTATTGCAATTTTTGCTGCCATTGC
GATTCCTAGCTATCAGGAATATATACGTCGTTCAAATCTAGCAATGGCTCAACAGGAAATGCAAAAACTAGCAGAACAGC
TTGAGCGTTATCGCTCTAGAAATTTTTCCTATAAAGGGTTTGATGCAACGTATTTATATCAAGATAAAAGTGGTCAAACC
CTTGCAAAATTTGATAGTACAAAACAGATTGTACAGCTACCATTAGATACATCAAATACAAAGTATACTTTGGCTGTTGT
AGATACAACAACCAATAATCCGTTACTAACTTCAGCAAATGCTATTGGACAGGGCTGGGCGATTAAGGCAATGAGTGCAG
ATAATAATAATTATTCATTATTGCTCACAAATACAGGATTTAGCTGTAAAAATAAAACATGGGCTAATATTAGTTCAAGC
TCCTGTGGTACAGGCTCGGAGAGTTGGTAA

Domains

Predicted by InterproScan.

• Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS) (29-113)

• Prokaryotic N-terminal methylation motif (N_methyl) (4-27)

3D structure

• AlphaFold DB: Q9X2M4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilY2	Acinetobacter baumannii D1279779	41.279	100	0.444

References

• [1]: Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714]
• [2]: Colleen G Leong et al. (2017) The role of core and accessory type IV pilus genes in natural transformation and twitching motility in the bacterium Acinetobacter baylyi. PloS One 12(8):e0182139. [PMID: 28771515]
• [3]: S Busch et al. (1999) Identification and characterization of ComE and ComF, two novel pilin-like competence factors involved in natural transformation of Acinetobacter sp. strain BD413. Applied And Environmental Microbiology 65(10):4568-74. [PMID: 10508090]