Detailed information    

experimental Experimentally validated

Overview


Name   pilL   Type   Machinery gene
Locus tag   NGFG_RS02440 Genome accession   NC_022240
Coordinates   449860..450333 (+) Length   157 a.a.
NCBI ID   WP_025455870.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae MS11     
Function   type IV pilus   
DNA binding and uptake

Function


Mutants lacking one of five newly discovered pilin-like proteins PilH–L were not transformable or were significantly reduced in transformation competence and were found not to localize ComP to the pili.


Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 445467..502121 449860..450333 within 0


Gene organization within MGE regions


Location: 445467..502121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NGFG_RS02415 (NGFG_00605) dnaB 445467..446873 (+) 1407 WP_003694974.1 replicative DNA helicase -
  NGFG_RS02420 (NGFG_00606) pilH 447028..447690 (+) 663 WP_003687912.1 GspH/FimT family pseudopilin Machinery gene
  NGFG_RS02425 (NGFG_00607) pilV 447722..448330 (+) 609 WP_003694976.1 type IV pilus modification protein PilV Regulator
  NGFG_RS02430 (NGFG_00608) pilJ 448327..449268 (+) 942 WP_003694978.1 PilW family protein Machinery gene
  NGFG_RS02435 (NGFG_00609) pilK 449247..449858 (+) 612 WP_003687918.1 pilus assembly PilX family protein Machinery gene
  NGFG_RS02440 (NGFG_00610) pilL 449860..450333 (+) 474 WP_025455870.1 PilX family type IV pilin Machinery gene
  NGFG_RS02445 (NGFG_00611) - 450403..450711 (-) 309 WP_010951048.1 AzlD family protein -
  NGFG_RS14980 - 450708..451415 (-) 708 Protein_464 AzlC family ABC transporter permease -
  NGFG_RS02455 (NGFG_00615) dut 451581..452033 (+) 453 WP_003687923.1 dUTP diphosphatase -
  NGFG_RS02460 (NGFG_00616) dapC 452111..453298 (+) 1188 WP_003687924.1 succinyldiaminopimelate transaminase -
  NGFG_RS02465 (NGFG_00617) yaaA 453609..454388 (+) 780 WP_003694987.1 peroxide stress protein YaaA -
  NGFG_RS02480 (NGFG_00618) - 454919..456115 (+) 1197 WP_017147117.1 tyrosine-type recombinase/integrase -
  NGFG_RS02490 (NGFG_00619) - 456471..456740 (-) 270 WP_003687928.1 hypothetical protein -
  NGFG_RS02495 (NGFG_00620) - 456935..457618 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  NGFG_RS16400 - 457899..458165 (-) 267 Protein_471 hypothetical protein -
  NGFG_RS02505 (NGFG_02285) - 458276..458491 (-) 216 WP_003691538.1 hypothetical protein -
  NGFG_RS02510 (NGFG_02286) - 458543..459034 (-) 492 WP_003696912.1 siphovirus Gp157 family protein -
  NGFG_RS02515 (NGFG_02287) - 459031..459213 (-) 183 WP_003691535.1 hypothetical protein -
  NGFG_RS02520 (NGFG_02288) - 459353..460039 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  NGFG_RS02525 (NGFG_02289) - 460108..460269 (-) 162 WP_003693867.1 hypothetical protein -
  NGFG_RS02530 (NGFG_00622) - 460266..460541 (-) 276 WP_003694990.1 NGO1622 family putative holin -
  NGFG_RS02535 (NGFG_00623) - 460694..461026 (-) 333 WP_003694992.1 hypothetical protein -
  NGFG_RS02540 - 461168..461374 (-) 207 WP_167549142.1 hypothetical protein -
  NGFG_RS15770 - 461441..461650 (-) 210 WP_245149592.1 DUF6948 domain-containing protein -
  NGFG_RS15775 - 461652..461918 (-) 267 WP_245149593.1 hypothetical protein -
  NGFG_RS02550 (NGFG_00626) - 461951..462151 (-) 201 WP_003687954.1 hypothetical protein -
  NGFG_RS02555 (NGFG_00627) - 462349..462762 (-) 414 WP_003687963.1 hypothetical protein -
  NGFG_RS02560 (NGFG_00628) - 462759..463220 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  NGFG_RS02565 (NGFG_00629) - 463237..463674 (-) 438 WP_003687967.1 hypothetical protein -
  NGFG_RS02570 (NGFG_00630) - 463787..464503 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  NGFG_RS12650 (NGFG_00631) - 464578..464808 (+) 231 WP_020997318.1 transcriptional regulator -
  NGFG_RS02575 (NGFG_02290) - 464888..465043 (+) 156 WP_003689578.1 hypothetical protein -
  NGFG_RS02580 (NGFG_02291) - 465020..465208 (-) 189 WP_003696008.1 hypothetical protein -
  NGFG_RS02585 (NGFG_02292) - 465382..465609 (+) 228 WP_017147225.1 helix-turn-helix domain-containing protein -
  NGFG_RS14985 (NGFG_02293) - 465606..465743 (+) 138 WP_017147224.1 hypothetical protein -
  NGFG_RS02590 (NGFG_02294) - 465727..466791 (+) 1065 WP_003689134.1 hypothetical protein -
  NGFG_RS02595 (NGFG_02295) - 466788..468149 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  NGFG_RS02600 - 468166..468411 (+) 246 WP_017147114.1 hypothetical protein -
  NGFG_RS02605 (NGFG_02296) - 468487..468942 (+) 456 WP_017147113.1 DUF3310 domain-containing protein -
  NGFG_RS02610 (NGFG_02297) - 468966..469115 (+) 150 WP_003689110.1 hypothetical protein -
  NGFG_RS15780 (NGFG_01306) - 469144..469425 (+) 282 WP_003689109.1 hypothetical protein -
  NGFG_RS02620 (NGFG_01306) - 469416..469796 (+) 381 WP_017147112.1 RusA family crossover junction endodeoxyribonuclease -
  NGFG_RS16255 - 469813..469941 (-) 129 WP_256263200.1 hypothetical protein -
  NGFG_RS02630 (NGFG_01305) - 470063..470470 (+) 408 WP_003691430.1 hypothetical protein -
  NGFG_RS02635 (NGFG_01304) - 470561..471721 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  NGFG_RS02640 (NGFG_01303) - 472003..472872 (+) 870 WP_003695486.1 BRO-N domain-containing protein -
  NGFG_RS02645 (NGFG_01302) - 473165..473614 (+) 450 WP_003695485.1 hypothetical protein -
  NGFG_RS02650 (NGFG_01301) terL 473676..475097 (+) 1422 WP_003689090.1 phage terminase large subunit -
  NGFG_RS02655 (NGFG_01300) - 475094..477241 (+) 2148 WP_003691423.1 phage portal protein -
  NGFG_RS02660 (NGFG_01299) - 477309..478466 (+) 1158 WP_003695482.1 HK97 family phage prohead protease -
  NGFG_RS02665 (NGFG_01298) - 478507..480006 (+) 1500 WP_003691419.1 hypothetical protein -
  NGFG_RS15425 (NGFG_01297) - 480013..480375 (+) 363 WP_003689082.1 hypothetical protein -
  NGFG_RS02675 (NGFG_01296) - 480378..480908 (+) 531 WP_003689080.1 head-tail connector protein -
  NGFG_RS02680 (NGFG_01295) - 480908..481390 (+) 483 WP_017147110.1 HK97 gp10 family phage protein -
  NGFG_RS02685 (NGFG_01294) - 481387..481815 (+) 429 WP_003689076.1 hypothetical protein -
  NGFG_RS02690 (NGFG_01293) - 481841..482614 (+) 774 WP_003692869.1 hypothetical protein -
  NGFG_RS02695 (NGFG_01292) - 482675..483004 (+) 330 WP_003689072.1 hypothetical protein -
  NGFG_RS02700 (NGFG_01291) - 483016..483282 (+) 267 WP_003689070.1 hypothetical protein -
  NGFG_RS02705 (NGFG_01290) - 483282..483881 (+) 600 WP_003691415.1 DUF2460 domain-containing protein -
  NGFG_RS02710 (NGFG_01289) - 483878..484732 (+) 855 WP_003689066.1 DUF2163 domain-containing protein -
  NGFG_RS02715 (NGFG_01288) - 484734..485165 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  NGFG_RS02720 - 485193..485471 (-) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  NGFG_RS02725 (NGFG_01286) - 485711..489855 (+) 4145 Protein_519 phage tail protein -
  NGFG_RS02730 (NGFG_01285) - 489967..490272 (+) 306 WP_003689058.1 hypothetical protein -
  NGFG_RS02735 (NGFG_01284) - 490343..490813 (+) 471 WP_003691410.1 hypothetical protein -
  NGFG_RS02740 (NGFG_01283) - 490814..491146 (+) 333 WP_003691408.1 hypothetical protein -
  NGFG_RS02745 (NGFG_01281) - 491502..491849 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  NGFG_RS02750 (NGFG_01280) - 491849..492085 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  NGFG_RS02755 (NGFG_01279) - 492292..492831 (+) 540 WP_003695466.1 TIGR02594 family protein -
  NGFG_RS02760 (NGFG_01278) - 492832..493176 (+) 345 WP_003695464.1 hypothetical protein -
  NGFG_RS14995 (NGFG_01277) - 493160..493333 (+) 174 WP_017146757.1 hypothetical protein -
  NGFG_RS02765 (NGFG_01275) - 493645..493794 (+) 150 WP_003691402.1 hypothetical protein -
  NGFG_RS02770 (NGFG_01274) - 493824..496871 (+) 3048 WP_003695458.1 tape measure protein -
  NGFG_RS02775 (NGFG_01273) - 496931..497410 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  NGFG_RS02780 (NGFG_01272) - 497752..498741 (-) 990 WP_003689040.1 tyrosine-type recombinase/integrase -
  NGFG_RS02785 - 499001..499189 (-) 189 WP_003689039.1 hypothetical protein -
  NGFG_RS02790 (NGFG_01270) purM 499430..500464 (+) 1035 WP_003689038.1 phosphoribosylformylglycinamidine cyclo-ligase -
  NGFG_RS02795 (NGFG_02301) - 501468..502121 (+) 654 WP_017147107.1 IS1595 family transposase -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17555.36 Da        Isoelectric Point: 9.4067

>NTDB_id=1140 NGFG_RS02440 WP_025455870.1 449860..450333(+) (pilL) [Neisseria gonorrhoeae MS11]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVRFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDATSAQVYLETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=1140 NGFG_RS02440 WP_025455870.1 449860..450333(+) (pilL) [Neisseria gonorrhoeae MS11]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAGGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCA
CTTCTGCCCAGGTCTATTTGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilX Neisseria meningitidis 8013

85.987

100

0.86


Multiple sequence alignment    



References


[1] Hanne C Winther-Larsen et al. (2005) A conserved set of pilin-like molecules controls type IV pilus dynamics and organelle-associated functions in Neisseria gonorrhoeae. Molecular Microbiology 56(4):903-17. [PMID: 15853879]