Detailed information    

experimental Experimentally validated

Overview


Name   pilV/pilI   Type   Regulator
Locus tag   NGFG_RS02425 Genome accession   NC_022240
Coordinates   447722..448330 (+) Length   202 a.a.
NCBI ID   WP_003694976.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae MS11     
Function   repress natural transformation; antagonize ComP   
Competence regulation

Function


The gonococcal PilV protein, structurally related to Tfp pilin subunits, is an intrinsic inhibitor of natural genetic transformation which acts ultimately by reducing the levels of sequence-specific DNA uptake into the cell. Specifically, we show that DNA uptake is enhanced in strains bearing pilV mutations and reduced in strains overexpressing PilV. Furthermore, we show that PilV exerts its effect by acting as an antagonist of ComP, a positive effector of sequence-specific DNA binding. As it prevents the accumulation of ComP at a site where it can be purified by shear extraction of intact cells, the data are most consistent with PilV either obstructing ComP trafficking or altering ComP stability.


Genomic Context


Location: 442722..453330
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NGFG_RS02400 (NGFG_00601) - 443320..443652 (+) 333 WP_003687908.1 hypothetical protein -
  NGFG_RS02405 (NGFG_00602) - 443983..444492 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  NGFG_RS02410 (NGFG_00603) - 444722..445303 (-) 582 WP_003687910.1 superoxide dismutase -
  NGFG_RS02415 (NGFG_00605) dnaB 445467..446873 (+) 1407 WP_003694974.1 replicative DNA helicase -
  NGFG_RS02420 (NGFG_00606) pilH 447028..447690 (+) 663 WP_003687912.1 GspH/FimT family pseudopilin Machinery gene
  NGFG_RS02425 (NGFG_00607) pilV/pilI 447722..448330 (+) 609 WP_003694976.1 type IV pilus modification protein PilV Regulator
  NGFG_RS02430 (NGFG_00608) pilJ 448327..449268 (+) 942 WP_003694978.1 PilW family protein Machinery gene
  NGFG_RS02435 (NGFG_00609) pilK 449247..449858 (+) 612 WP_003687918.1 pilus assembly PilX family protein Machinery gene
  NGFG_RS02440 (NGFG_00610) pilL 449860..450333 (+) 474 WP_025455870.1 PilX family type IV pilin Machinery gene
  NGFG_RS02445 (NGFG_00611) - 450403..450711 (-) 309 WP_010951048.1 AzlD family protein -
  NGFG_RS14980 - 450708..451415 (-) 708 Protein_464 AzlC family ABC transporter permease -
  NGFG_RS02455 (NGFG_00615) dut 451581..452033 (+) 453 WP_003687923.1 dUTP diphosphatase -
  NGFG_RS02460 (NGFG_00616) dapC 452111..453298 (+) 1188 WP_003687924.1 succinyldiaminopimelate transaminase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  pilV/pilI comP negative effect

Sequence


Protein


Download         Length: 202 a.a.        Molecular weight: 21951.89 Da        Isoelectric Point: 4.9807

>NTDB_id=1121 NGFG_RS02425 WP_003694976.1 447722..448330(+) (pilV/pilI) [Neisseria gonorrhoeae MS11]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLINPTIDSDSNKKN
YNLYTGSYAPTSSDGDFKLNNLISKTDLAKAQLDRFGYELKQALPDAVAIRYAVCKDSSGDAPTLSGNTFSSNCDKKANG
DTLIKVLWVNDSAGDSDIFRTNLEVSGSNIVYTYQARVGGRE

Nucleotide


Download         Length: 609 bp        

>NTDB_id=1121 NGFG_RS02425 WP_003694976.1 447722..448330(+) (pilV/pilI) [Neisseria gonorrhoeae MS11]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACGGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATCAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGGGTCGTACGCCCCCACTTCCTCTGACGGCGATTTCAAGCTTAATAATTTGATAAGTAAGACGGA
TTTGGCAAAAGCCCAGTTGGACAGGTTCGGTTATGAATTGAAACAAGCCTTGCCGGATGCGGTAGCTATTCGTTACGCCG
TCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGGCAATACTTTTTCTTCAAATTGCGACAAGAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTTCCGTACGAATCTTGAAGTGAGCGG
CAGCAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilV Neisseria meningitidis 8013

83.981

100

0.856


Multiple sequence alignment    



References


[1] Hanne C Winther-Larsen et al. (2005) A conserved set of pilin-like molecules controls type IV pilus dynamics and organelle-associated functions in Neisseria gonorrhoeae. Molecular Microbiology 56(4):903-17. [PMID: 15853879]
[2] Finn Erik Aas et al. (2002) An inhibitor of DNA binding and uptake events dictates the proficiency of genetic transformation in Neisseria gonorrhoeae: mechanism of action and links to Type IV pilus expression. Molecular Microbiology 46(5):1441-50. [PMID: 12453228]
[3] H C Winther-Larsen et al. (2001) Neisseria gonorrhoeae PilV, a type IV pilus-associated protein essential to human epithelial cell adherence. Proceedings of The National Academy of Sciences of The United States of America 98(26):15276-81. [PMID: 11752467]