Detailed information NTG0001121

Experimentally validated

Overview

• Name: pilV
• Type: Regulator
• Locus tag: NGFG_RS02425
• Genome accession: NC_022240
• Coordinates: 447722..448330 (+)
• Length: 202 a.a.
• NCBI ID: WP_003694976.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae MS11
• Function: repress natural transformation; antagonize ComP Competence regulation

Function

The gonococcal PilV protein, structurally related to Tfp pilin subunits, is an intrinsic inhibitor of natural genetic transformation which acts ultimately by reducing the levels of sequence-specific DNA uptake into the cell. Specifically, we show that DNA uptake is enhanced in strains bearing pilV mutations and reduced in strains overexpressing PilV. Furthermore, we show that PilV exerts its effect by acting as an antagonist of ComP, a positive effector of sequence-specific DNA binding. As it prevents the accumulation of ComP at a site where it can be purified by shear extraction of intact cells, the data are most consistent with PilV either obstructing ComP trafficking or altering ComP stability.

Genomic Context

Location: 442722..453330

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NGFG_RS02400 (NGFG_00601)	-	443320..443652 (+)	333	WP_003687908.1	hypothetical protein	-
NGFG_RS02405 (NGFG_00602)	-	443983..444492 (+)	510	WP_003687909.1	isoprenylcysteine carboxyl methyltransferase family protein	-
NGFG_RS02410 (NGFG_00603)	-	444722..445303 (-)	582	WP_003687910.1	superoxide dismutase	-
NGFG_RS02415 (NGFG_00605)	dnaB	445467..446873 (+)	1407	WP_003694974.1	replicative DNA helicase	-
NGFG_RS02420 (NGFG_00606)	pilH	447028..447690 (+)	663	WP_003687912.1	GspH/FimT family pseudopilin	Machinery gene
NGFG_RS02425 (NGFG_00607)	pilV	447722..448330 (+)	609	WP_003694976.1	type IV pilus modification protein PilV	Regulator
NGFG_RS02430 (NGFG_00608)	pilJ	448327..449268 (+)	942	WP_003694978.1	PilW family protein	Machinery gene
NGFG_RS02435 (NGFG_00609)	pilK	449247..449858 (+)	612	WP_003687918.1	pilus assembly PilX family protein	Machinery gene
NGFG_RS02440 (NGFG_00610)	pilL	449860..450333 (+)	474	WP_025455870.1	PilX family type IV pilin	Machinery gene
NGFG_RS02445 (NGFG_00611)	-	450403..450711 (-)	309	WP_010951048.1	AzlD family protein	-
NGFG_RS14980	-	450708..451415 (-)	708	Protein_464	AzlC family ABC transporter permease	-
NGFG_RS02455 (NGFG_00615)	dut	451581..452033 (+)	453	WP_003687923.1	dUTP diphosphatase	-
NGFG_RS02460 (NGFG_00616)	dapC	452111..453298 (+)	1188	WP_003687924.1	succinyldiaminopimelate transaminase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
pilV	comP	negative effect

Sequence

Protein

• Length: 202 a.a.
• Molecular weight: 21951.89 Da
• Isoelectric Point: 4.9807

>NTDB_id=1121 NGFG_RS02425 WP_003694976.1 447722..448330(+) (pilV) [Neisseria gonorrhoeae MS11]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLINPTIDSDSNKKN
YNLYTGSYAPTSSDGDFKLNNLISKTDLAKAQLDRFGYELKQALPDAVAIRYAVCKDSSGDAPTLSGNTFSSNCDKKANG
DTLIKVLWVNDSAGDSDIFRTNLEVSGSNIVYTYQARVGGRE

Nucleotide

• Length: 609 bp

>NTDB_id=1121 NGFG_RS02425 WP_003694976.1 447722..448330(+) (pilV) [Neisseria gonorrhoeae MS11]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACGGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATCAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGGGGTCGTACGCCCCCACTTCCTCTGACGGCGATTTCAAGCTTAATAATTTGATAAGTAAGACGGA
TTTGGCAAAAGCCCAGTTGGACAGGTTCGGTTATGAATTGAAACAAGCCTTGCCGGATGCGGTAGCTATTCGTTACGCCG
TCTGCAAGGATTCGTCGGGTGACGCGCCGACATTGTCCGGCAATACTTTTTCTTCAAATTGCGACAAGAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTTCCGTACGAATCTTGAAGTGAGCGG
CAGCAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-36)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilI	Neisseria gonorrhoeae MS11	100	100	1
pilV	Neisseria meningitidis 8013	83.981	100	0.856

References

• [1]: Finn Erik Aas et al. (2002) An inhibitor of DNA binding and uptake events dictates the proficiency of genetic transformation in Neisseria gonorrhoeae: mechanism of action and links to Type IV pilus expression. Molecular Microbiology 46(5):1441-50. [PMID: 12453228]
• [2]: H C Winther-Larsen et al. (2001) Neisseria gonorrhoeae PilV, a type IV pilus-associated protein essential to human epithelial cell adherence. Proceedings of The National Academy of Sciences of The United States of America 98(26):15276-81. [PMID: 11752467]