Detailed information NTG0001309

Experimentally validated

Overview

• Name: pilV
• Type: Machinery gene
• Locus tag: DR_RS02825
• Genome accession: NC_001263
• Coordinates: 553128..553604 (-)
• Length: 158 a.a.
• NCBI ID: WP_034349477.1
• Uniprot ID: -
• Organism: Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539
• Function: assembly of type IV pilus DNA binding and uptake

Function

We identified the factors (PilQ, PilD, type IV pilins, PilB, PilT, ComEC-ComEA, and ComF) involved in DNA uptake and DNA translocation across the external and cytoplasmic membranes and showed that the DNA-uptake machinery is similar to that described in the Gram negative bacterium Vibrio cholerae.

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	536164..553085	553128..553604	flank	43

Gene organization within MGE regions

Location: 536164..553604

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DR_RS02755 (DR_0534)	-	536164..538266 (-)	2103	WP_010887179.1	protein kinase domain-containing protein	-
DR_RS02760 (DR_0535)	-	538235..540829 (-)	2595	WP_027479533.1	hypothetical protein	-
DR_RS02765 (DR_0536)	-	540833..541438 (-)	606	WP_010887181.1	OmpA family protein	-
DR_RS02770 (DR_0537)	-	541463..542533 (-)	1071	WP_227085990.1	hypothetical protein	-
DR_RS02775 (DR_0538)	-	542702..545902 (-)	3201	WP_227085991.1	tubulin-like doman-containing protein	-
DR_RS02780 (DR_0539)	-	545914..546243 (-)	330	WP_010887184.1	hypothetical protein	-
DR_RS02785 (DR_0540)	-	546243..547562 (-)	1320	WP_162177565.1	hypothetical protein	-
DR_RS02790 (DR_0541)	-	547773..548567 (-)	795	WP_034349478.1	DUF72 domain-containing protein	-
DR_RS02795 (DR_0542)	-	548592..549269 (-)	678	WP_010887187.1	glycerophosphodiester phosphodiesterase	-
DR_RS02800 (DR_0543)	-	549374..550057 (+)	684	WP_010887188.1	SDR family oxidoreductase	-
DR_RS02805 (DR_0544)	-	550134..550901 (+)	768	WP_010887189.1	sulfite exporter TauE/SafE family protein	-
DR_RS02810 (DR_0545)	-	550898..551173 (+)	276	WP_027479532.1	hypothetical protein	-
DR_RS02815 (DR_0546)	-	551157..551534 (-)	378	WP_010887191.1	type IV pilin protein	-
DR_RS02820 (DR_0547)	-	551901..553085 (+)	1185	WP_162177563.1	HTTM domain-containing protein	-
DR_RS02825	pilV	553128..553604 (-)	477	WP_034349477.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene

Sequence

Protein

• Length: 158 a.a.
• Molecular weight: 15369.17 Da
• Isoelectric Point: 7.5899

>NTDB_id=1309 DR_RS02825 WP_034349477.1 553128..553604(-) (pilV) [Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539]
MKNTTQGFTLIELLIVIAIIGILAAVLIPNLLGARAKANDSATQSYIRNCYTAVEVARGADGRLPAAGNCDSTANLGTNA
VATPGAITAAGAYSLDGTGSKFAVTATSVTNKTFCFDGAKMGEGTGATGACTFSTSTGTGTGTGTGTGTGTGTGTGSN

Nucleotide

• Length: 477 bp

>NTDB_id=1309 DR_RS02825 WP_034349477.1 553128..553604(-) (pilV) [Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539]
ATGAAGAACACCACCCAAGGCTTCACCCTGATCGAACTGCTCATCGTCATCGCCATCATCGGCATCCTGGCCGCCGTGTT
GATCCCCAACCTGCTGGGCGCCCGCGCCAAGGCCAACGACAGCGCCACCCAGAGCTACATCCGCAACTGCTACACCGCCG
TGGAAGTGGCCCGTGGTGCTGACGGCCGCCTGCCTGCTGCTGGCAACTGCGACAGCACGGCCAACCTGGGTACCAACGCT
GTGGCTACCCCTGGTGCAATCACTGCGGCAGGCGCTTACAGCCTGGATGGTACTGGTAGCAAGTTTGCCGTTACTGCCAC
CAGCGTGACCAACAAGACCTTCTGCTTCGACGGCGCGAAGATGGGCGAAGGCACTGGCGCTACTGGTGCCTGCACCTTCA
GCACCAGCACCGGCACCGGCACTGGTACCGGCACTGGTACCGGCACTGGCACCGGCACTGGTACCGGCAGCAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-27)

• Pilin A4 (PilA4) (39-124)

References

• [1]: Solenne Ithurbide et al. (2020) Natural Transformation in Deinococcus radiodurans: A Genetic Analysis Reveals the Major Roles of DprA, DdrB, RecA, RecF, and RecO Proteins. Frontiers in Microbiology 11:1253. [PMID: 32625182]