Detailed information    

experimental Experimentally validated

Overview

Name   pilV   Type   Machinery gene
Locus tag   DR_RS02825 Genome accession   NC_001263
Coordinates   553128..553604 (-) Length   158 a.a.
NCBI ID   WP_034349477.1    Uniprot ID   -
Organism   Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539     
Function   assembly of type IV pilus   
DNA binding and uptake

Function

We identified the factors (PilQ, PilD, type IV pilins, PilB, PilT, ComEC-ComEA, and ComF) involved in DNA uptake and DNA translocation across the external and cytoplasmic membranes and showed that the DNA-uptake machinery is similar to that described in the Gram negative bacterium Vibrio cholerae.


Genomic Context

Location: 548128..558604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DR_RS02795 (DR_0542) - 548592..549269 (-) 678 WP_010887187.1 glycerophosphodiester phosphodiesterase -
  DR_RS02800 (DR_0543) - 549374..550057 (+) 684 WP_010887188.1 SDR family oxidoreductase -
  DR_RS02805 (DR_0544) - 550134..550901 (+) 768 WP_010887189.1 sulfite exporter TauE/SafE family protein -
  DR_RS02810 (DR_0545) - 550898..551173 (+) 276 WP_027479532.1 hypothetical protein -
  DR_RS02815 (DR_0546) pilV 551157..551534 (-) 378 WP_010887191.1 type IV pilin protein Machinery gene
  DR_RS02820 (DR_0547) - 551901..553085 (+) 1185 WP_162177563.1 HTTM domain-containing protein -
  DR_RS02825 pilV 553128..553604 (-) 477 WP_034349477.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  DR_RS02830 (DR_0549) dnaB 554038..555384 (+) 1347 WP_010887194.1 replicative DNA helicase -
  DR_RS02835 (DR_0550) - 555381..556133 (+) 753 WP_010887195.1 NUDIX domain-containing protein -
  DR_RS02840 (DR_0551) - 556197..557555 (-) 1359 WP_027479530.1 acyl-CoA dehydrogenase family protein -
  DR_RS02845 (DR_0552) - 557655..558275 (+) 621 WP_010887197.1 thiamine diphosphokinase -

Sequence

Protein


Download         Length: 158 a.a.        Molecular weight: 15369.17 Da        Isoelectric Point: 7.5899

>NTDB_id=1309 DR_RS02825 WP_034349477.1 553128..553604(-) (pilV) [Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539]
MKNTTQGFTLIELLIVIAIIGILAAVLIPNLLGARAKANDSATQSYIRNCYTAVEVARGADGRLPAAGNCDSTANLGTNA
VATPGAITAAGAYSLDGTGSKFAVTATSVTNKTFCFDGAKMGEGTGATGACTFSTSTGTGTGTGTGTGTGTGTGTGSN

Nucleotide


Download         Length: 477 bp        

>NTDB_id=1309 DR_RS02825 WP_034349477.1 553128..553604(-) (pilV) [Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539]
ATGAAGAACACCACCCAAGGCTTCACCCTGATCGAACTGCTCATCGTCATCGCCATCATCGGCATCCTGGCCGCCGTGTT
GATCCCCAACCTGCTGGGCGCCCGCGCCAAGGCCAACGACAGCGCCACCCAGAGCTACATCCGCAACTGCTACACCGCCG
TGGAAGTGGCCCGTGGTGCTGACGGCCGCCTGCCTGCTGCTGGCAACTGCGACAGCACGGCCAACCTGGGTACCAACGCT
GTGGCTACCCCTGGTGCAATCACTGCGGCAGGCGCTTACAGCCTGGATGGTACTGGTAGCAAGTTTGCCGTTACTGCCAC
CAGCGTGACCAACAAGACCTTCTGCTTCGACGGCGCGAAGATGGGCGAAGGCACTGGCGCTACTGGTGCCTGCACCTTCA
GCACCAGCACCGGCACCGGCACTGGTACCGGCACTGGTACCGGCACTGGCACCGGCACTGGTACCGGCAGCAACTAA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(5-27)

Pilin A4 (PilA4)

(39-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Solenne Ithurbide et al. (2020) Natural Transformation in Deinococcus radiodurans: A Genetic Analysis Reveals the Major Roles of DprA, DdrB, RecA, RecF, and RecO Proteins. Frontiers in Microbiology 11:1253. [PMID: 32625182]