Detailed information NTG0548909

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: J4H94_RS21570
• Genome accession: NZ_CP071899
• Coordinates: 1006019..1006204 (-)
• Length: 61 a.a.
• NCBI ID: WP_133456153.1
• Uniprot ID: -
• Organism: Stutzerimonas frequens strain TPA3
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1001019..1011204

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J4H94_RS04685 (J4H94_04685)	-	1002793..1003689 (-)	897	WP_208217599.1	ABC transporter ATP-binding protein	-
J4H94_RS04690 (J4H94_04690)	-	1003686..1004522 (-)	837	WP_166082509.1	hypothetical protein	-
J4H94_RS04695 (J4H94_04695)	-	1004524..1005333 (-)	810	WP_166082500.1	ABC transporter permease subunit	-
J4H94_RS04700 (J4H94_04700)	-	1005549..1006001 (-)	453	WP_133456154.1	hypothetical protein	-
J4H94_RS21570 (J4H94_04705)	pilA	1006019..1006204 (-)	186	WP_133456153.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
J4H94_RS04710 (J4H94_04710)	pilB	1006643..1008346 (+)	1704	WP_208217600.1	type IV-A pilus assembly ATPase PilB	Machinery gene
J4H94_RS04715 (J4H94_04715)	pilC	1008349..1009569 (+)	1221	WP_133456151.1	type II secretion system F family protein	Machinery gene
J4H94_RS04720 (J4H94_04720)	pilD	1009573..1010439 (+)	867	WP_133456150.1	A24 family peptidase	Machinery gene
J4H94_RS04725 (J4H94_04725)	coaE	1010573..1011181 (+)	609	WP_208217601.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6614.00 Da
• Isoelectric Point: 10.4849

>NTDB_id=548909 J4H94_RS21570 WP_133456153.1 1006019..1006204(-) (pilA) [Stutzerimonas frequens strain TPA3]
MKSIKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSSAKADTKNMITVMSAAMI

Nucleotide

• Length: 186 bp

>NTDB_id=548909 J4H94_RS21570 WP_133456153.1 1006019..1006204(-) (pilA) [Stutzerimonas frequens strain TPA3]
ATGAAATCCATCAAGAAGCAAAAAGGTTTTACCTTGATTGAACTGATGATCGTGGTTGCGATCATCGGCATTCTAGCGGC
CATTGCCATTCCGCAGTTCAACGAGTATCGCGCTAAGGCGAACGACTCTTCGGCCAAAGCTGACACAAAGAACATGATCA
CCGTCATGTCCGCGGCAATGATCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	59.649	93.443	0.557
pilA/pilA1	Eikenella corrodens VA1	55.556	88.525	0.492
comP	Acinetobacter baylyi ADP1	58.824	83.607	0.492
pilA	Vibrio parahaemolyticus RIMD 2210633	60	81.967	0.492
pilA	Acinetobacter nosocomialis M2	76.923	63.934	0.492
pilA2	Legionella pneumophila strain ERS1305867	61.224	80.328	0.492
pilA2	Legionella pneumophila str. Paris	61.224	80.328	0.492
pilA	Acinetobacter baumannii strain A118	85.294	55.738	0.475
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	55.769	85.246	0.475
pilA	Ralstonia pseudosolanacearum GMI1000	64.444	73.77	0.475
pilA/pilAI	Pseudomonas stutzeri DSM 10701	66.667	68.852	0.459
pilA	Vibrio campbellii strain DS40M4	77.778	59.016	0.459
pilA/pilAII	Pseudomonas stutzeri DSM 10701	57.143	80.328	0.459
pilA	Vibrio cholerae C6706	75	59.016	0.443
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	75	59.016	0.443
pilA	Vibrio cholerae strain A1552	75	59.016	0.443
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	66.667	63.934	0.426
pilE	Neisseria gonorrhoeae strain FA1090	66.667	63.934	0.426
pilE	Neisseria gonorrhoeae MS11	66.667	63.934	0.426
comF	Acinetobacter baylyi ADP1	55.556	73.77	0.41
pilA	Haemophilus influenzae Rd KW20	70.588	55.738	0.393
pilA	Haemophilus influenzae 86-028NP	70.588	55.738	0.393
pilA	Glaesserella parasuis strain SC1401	69.697	54.098	0.377
pilA/pilA4	Thermus thermophilus HB27	57.5	65.574	0.377
pilX	Neisseria meningitidis 8013	60.526	62.295	0.377
pilL	Neisseria gonorrhoeae MS11	60.526	62.295	0.377
pilA/pilA1	Synechocystis sp. PCC 6803	53.488	70.492	0.377
fimU	Acinetobacter baumannii D1279779	36.667	98.361	0.361
comE	Acinetobacter baylyi ADP1	59.459	60.656	0.361