Detailed information NTG0087712

Bioinformatically predicted

Overview

• Name: pilV
• Type: Machinery gene
• Locus tag: PszF2a_RS21525
• Genome accession: NZ_AP024722
• Coordinates: 1030872..1031051 (-)
• Length: 59 a.a.
• NCBI ID: WP_125877172.1
• Uniprot ID: -
• Organism: Stutzerimonas stutzeri strain F2a
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1025872..1036051

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PszF2a_RS04870 (PszF2a_09570)	-	1027723..1028619 (-)	897	WP_221293033.1	ABC transporter ATP-binding protein	-
PszF2a_RS04875 (PszF2a_09580)	-	1028616..1029359 (-)	744	WP_245002918.1	hypothetical protein	-
PszF2a_RS04880 (PszF2a_09590)	-	1029454..1030263 (-)	810	WP_245002919.1	hypothetical protein	-
PszF2a_RS04885	-	1030404..1030856 (-)	453	WP_125877166.1	hypothetical protein	-
PszF2a_RS21525 (PszF2a_09600)	pilV	1030872..1031051 (-)	180	WP_125877172.1	type IV pilin protein	Machinery gene
PszF2a_RS04895 (PszF2a_09610)	pilB	1031428..1033131 (+)	1704	WP_125877164.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PszF2a_RS04900 (PszF2a_09620)	pilC	1033134..1034354 (+)	1221	WP_125877162.1	type II secretion system F family protein	Machinery gene
PszF2a_RS04905 (PszF2a_09630)	pilD	1034358..1035224 (+)	867	WP_221293034.1	prepilin peptidase	Machinery gene
PszF2a_RS04910	coaE	1035356..1035964 (+)	609	WP_080977605.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 59 a.a.
• Molecular weight: 6427.79 Da
• Isoelectric Point: 10.4849

>NTDB_id=87712 PszF2a_RS21525 WP_125877172.1 1030872..1031051(-) (pilV) [Stutzerimonas stutzeri strain F2a]
MKKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSTAKADTKNMITVMSAAMI

Nucleotide

• Length: 180 bp

>NTDB_id=87712 PszF2a_RS21525 WP_125877172.1 1030872..1031051(-) (pilV) [Stutzerimonas stutzeri strain F2a]
ATGAAGAAGAAGCAAAAGGGCTTTACCTTGATTGAGCTGATGATCGTAGTGGCGATCATCGGCATTCTGGCTGCGATTGC
TATTCCGCAGTTCAATGAATATCGCGCCAAGGCGAATGATTCCACTGCCAAAGCCGACACCAAGAACATGATCACCGTCA
TGTCTGCAGCAATGATCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	58.929	94.915	0.559
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	54.386	96.61	0.525
comP	Acinetobacter baylyi ADP1	58.824	86.441	0.508
pilA	Acinetobacter nosocomialis M2	76.923	66.102	0.508
pilA2	Legionella pneumophila str. Paris	61.224	83.051	0.508
pilA2	Legionella pneumophila strain ERS1305867	61.224	83.051	0.508
pilA	Vibrio parahaemolyticus RIMD 2210633	56.863	86.441	0.492
pilA	Acinetobacter baumannii strain A118	85.294	57.627	0.492
pilA	Vibrio campbellii strain DS40M4	75.676	62.712	0.475
pilA/pilA1	Eikenella corrodens VA1	73.684	64.407	0.475
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	65.116	72.881	0.475
pilE	Neisseria gonorrhoeae strain FA1090	62.791	72.881	0.458
pilA	Ralstonia pseudosolanacearum GMI1000	72.973	62.712	0.458
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	75	61.017	0.458
pilA	Vibrio cholerae strain A1552	75	61.017	0.458
pilA	Vibrio cholerae C6706	75	61.017	0.458
pilE	Neisseria gonorrhoeae MS11	66.667	66.102	0.441
pilA/pilAI	Pseudomonas stutzeri DSM 10701	74.286	59.322	0.441
comF	Acinetobacter baylyi ADP1	59.524	71.186	0.424
pilA/pilAII	Pseudomonas stutzeri DSM 10701	54.348	77.966	0.424
pilA	Haemophilus influenzae 86-028NP	70.588	57.627	0.407
pilA	Haemophilus influenzae Rd KW20	70.588	57.627	0.407
pilA/pilA1	Synechocystis sp. PCC 6803	54.545	74.576	0.407
pilA	Glaesserella parasuis strain SC1401	69.697	55.932	0.39
pilX	Neisseria meningitidis 8013	60.526	64.407	0.39
pilL	Neisseria gonorrhoeae MS11	60.526	64.407	0.39
comE	Acinetobacter baylyi ADP1	58.974	66.102	0.39
pilA/pilA4	Thermus thermophilus HB27	58.974	66.102	0.39