Detailed information NTG0219102

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: B2D37_RS23985
• Genome accession: NZ_CP019947
• Coordinates: 2976215..2976400 (-)
• Length: 61 a.a.
• NCBI ID: WP_079203185.1
• Uniprot ID: -
• Organism: Pseudomonas sp. CC6-YY-74
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2971215..2981400

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
B2D37_RS13570	-	2972851..2973792 (-)	942	WP_079203183.1	ABC transporter ATP-binding protein	-
B2D37_RS13575	-	2973789..2974628 (-)	840	WP_079203184.1	hypothetical protein	-
B2D37_RS13580	-	2974630..2975439 (-)	810	WP_256573079.1	ABC transporter permease subunit	-
B2D37_RS23120	-	2975742..2976200 (-)	459	WP_154067090.1	hypothetical protein	-
B2D37_RS23985	pilA	2976215..2976400 (-)	186	WP_079203185.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
B2D37_RS13590	pilB	2976633..2978336 (+)	1704	WP_079203186.1	type IV-A pilus assembly ATPase PilB	Machinery gene
B2D37_RS13595	pilC	2978340..2979560 (+)	1221	WP_079203187.1	type II secretion system F family protein	Machinery gene
B2D37_RS13600	pilD	2979564..2980433 (+)	870	WP_154067091.1	A24 family peptidase	Machinery gene

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6671.00 Da
• Isoelectric Point: 10.5719

>NTDB_id=219102 B2D37_RS23985 WP_079203185.1 2976215..2976400(-) (pilA) [Pseudomonas sp. CC6-YY-74]
MKSLKKQKGFTLIELMIVIAIIGILAAIAIPQFNDYRAKANDSLALADNKNMVTSFSAAMR

Nucleotide

• Length: 186 bp

>NTDB_id=219102 B2D37_RS23985 WP_079203185.1 2976215..2976400(-) (pilA) [Pseudomonas sp. CC6-YY-74]
ATGAAGTCTCTCAAGAAACAAAAAGGTTTTACCCTGATCGAACTGATGATCGTGATTGCAATTATCGGGATTTTGGCTGC
TATCGCTATTCCGCAGTTTAATGACTACCGCGCGAAAGCGAATGACTCCCTGGCTCTTGCTGACAACAAGAATATGGTTA
CGTCGTTTTCTGCAGCAATGCGATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Ralstonia pseudosolanacearum GMI1000	54.545	100	0.59
pilA2	Legionella pneumophila str. Paris	61.818	90.164	0.557
pilA2	Legionella pneumophila strain ERS1305867	61.818	90.164	0.557
pilA/pilA1	Eikenella corrodens VA1	58.929	91.803	0.541
pilA	Pseudomonas aeruginosa PAK	57.895	93.443	0.541
comP	Acinetobacter baylyi ADP1	61.111	88.525	0.541
pilE	Neisseria gonorrhoeae strain FA1090	58.491	86.885	0.508
pilE	Neisseria gonorrhoeae MS11	58.491	86.885	0.508
pilA	Acinetobacter baumannii strain A118	51.724	95.082	0.492
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	57.692	85.246	0.492
pilA/pilAI	Pseudomonas stutzeri DSM 10701	69.048	68.852	0.475
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	72.5	65.574	0.475
pilA	Acinetobacter nosocomialis M2	65.909	72.131	0.475
pilA	Vibrio campbellii strain DS40M4	77.778	59.016	0.459
pilA	Vibrio parahaemolyticus RIMD 2210633	56	81.967	0.459
pilA	Vibrio cholerae strain A1552	63.636	72.131	0.459
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	63.636	72.131	0.459
pilA	Vibrio cholerae C6706	63.636	72.131	0.459
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
pilA/pilA4	Thermus thermophilus HB27	56.818	72.131	0.41
pilA	Haemophilus influenzae 86-028NP	73.529	55.738	0.41
pilA	Haemophilus influenzae Rd KW20	73.529	55.738	0.41
comF	Acinetobacter baylyi ADP1	60	65.574	0.393
pilA	Glaesserella parasuis strain SC1401	72.727	54.098	0.393
comE	Acinetobacter baylyi ADP1	50	75.41	0.377
comGD	Latilactobacillus sakei subsp. sakei 23K	41.071	91.803	0.377
pilX	Neisseria meningitidis 8013	57.895	62.295	0.361
pilL	Neisseria gonorrhoeae MS11	57.895	62.295	0.361
pilY2	Acinetobacter baumannii D1279779	48.889	73.77	0.361