Detailed information
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | ACMYQ0_RS13965 | Genome accession | NZ_CP180477 |
| Coordinates | 3002125..3002310 (-) | Length | 61 a.a. |
| NCBI ID | WP_415753510.1 | Uniprot ID | - |
| Organism | Pseudomonas leptonychotis strain CCM 8849 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2998652..3007570 | 3002125..3002310 | within | 0 |
Gene organization within MGE regions
Location: 2998652..3007570
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACMYQ0_RS13940 | - | 2998652..2999551 (-) | 900 | WP_415753505.1 | ABC transporter ATP-binding protein | - |
| ACMYQ0_RS13945 | - | 2999554..3000387 (-) | 834 | WP_415753506.1 | hypothetical protein | - |
| ACMYQ0_RS13950 | - | 3000389..3001198 (-) | 810 | WP_415753507.1 | hypothetical protein | - |
| ACMYQ0_RS13955 | - | 3001302..3001535 (-) | 234 | WP_415753508.1 | type IV pilin protein | - |
| ACMYQ0_RS13960 | - | 3001633..3002109 (-) | 477 | WP_415753509.1 | hypothetical protein | - |
| ACMYQ0_RS13965 | pilA | 3002125..3002310 (-) | 186 | WP_415753510.1 | type IV pilin protein | Machinery gene |
| ACMYQ0_RS13970 | pilB | 3002544..3004247 (+) | 1704 | WP_415753511.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| ACMYQ0_RS13975 | pilC | 3004250..3005470 (+) | 1221 | WP_415753512.1 | type II secretion system F family protein | Machinery gene |
| ACMYQ0_RS13980 | pilD | 3005477..3006343 (+) | 867 | WP_415753513.1 | prepilin peptidase | Machinery gene |
| ACMYQ0_RS13985 | coaE | 3006500..3007114 (+) | 615 | WP_415753514.1 | dephospho-CoA kinase | - |
| ACMYQ0_RS13990 | yacG | 3007111..3007311 (+) | 201 | WP_415753515.1 | DNA gyrase inhibitor YacG | - |
| ACMYQ0_RS13995 | - | 3007355..3007570 (-) | 216 | WP_415753516.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6537.78 Da Isoelectric Point: 10.2806
>NTDB_id=1095982 ACMYQ0_RS13965 WP_415753510.1 3002125..3002310(-) (pilA) [Pseudomonas leptonychotis strain CCM 8849]
MKSLKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKSNDTVATADAKNAITTMASAQL
MKSLKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKSNDTVATADAKNAITTMASAQL
Nucleotide
Download Length: 186 bp
>NTDB_id=1095982 ACMYQ0_RS13965 WP_415753510.1 3002125..3002310(-) (pilA) [Pseudomonas leptonychotis strain CCM 8849]
ATGAAGTCTCTCAAGAAGCAAAAAGGTTTTACCCTGATCGAGCTGATGATCGTTGTTGCGATTATTGGTATTTTGGCTGC
TATTGCTATCCCGCAGTTTAATGAGTATCGCGCCAAGTCGAACGACACTGTCGCTACTGCGGATGCGAAAAATGCAATTA
CCACTATGGCCTCGGCCCAGCTTTAA
ATGAAGTCTCTCAAGAAGCAAAAAGGTTTTACCCTGATCGAGCTGATGATCGTTGTTGCGATTATTGGTATTTTGGCTGC
TATTGCTATCCCGCAGTTTAATGAGTATCGCGCCAAGTCGAACGACACTGTCGCTACTGCGGATGCGAAAAATGCAATTA
CCACTATGGCCTCGGCCCAGCTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.