Detailed information NTG1065787

Bioinformatically predicted

Overview

• Name: pilV
• Type: Machinery gene
• Locus tag: ACH105_RS15855
• Genome accession: NZ_CP172234
• Coordinates: 3372970..3373155 (+)
• Length: 61 a.a.
• NCBI ID: WP_272890074.1
• Uniprot ID: -
• Organism: Stutzerimonas balearica strain Y11
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3367970..3378155

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACH105_RS15835 (ACH105_15835)	coaE	3368107..3368715 (-)	609	WP_312380414.1	dephospho-CoA kinase	-
ACH105_RS15840 (ACH105_15840)	pilD	3368809..3369678 (-)	870	WP_395763935.1	prepilin peptidase	Machinery gene
ACH105_RS15845 (ACH105_15845)	pilC	3369675..3370895 (-)	1221	WP_061340859.1	type II secretion system F family protein	Machinery gene
ACH105_RS15850 (ACH105_15850)	pilB	3370898..3372601 (-)	1704	WP_395763936.1	type IV-A pilus assembly ATPase PilB	Machinery gene
ACH105_RS15855 (ACH105_15855)	pilV	3372970..3373155 (+)	186	WP_272890074.1	type IV pilin protein	Machinery gene
ACH105_RS15860 (ACH105_15860)	-	3373175..3373642 (+)	468	WP_145996470.1	hypothetical protein	-
ACH105_RS15865 (ACH105_15865)	-	3374275..3374997 (+)	723	WP_395763937.1	hypothetical protein	-
ACH105_RS15870 (ACH105_15870)	-	3374999..3375838 (+)	840	WP_395764862.1	hypothetical protein	-
ACH105_RS15875 (ACH105_15875)	-	3375835..3376731 (+)	897	WP_395763938.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6603.89 Da
• Isoelectric Point: 10.5719

>NTDB_id=1065787 ACH105_RS15855 WP_272890074.1 3372970..3373155(+) (pilV) [Stutzerimonas balearica strain Y11]
MKSIKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSTAQADAKNILTVMAAAQR

Nucleotide

• Length: 186 bp

>NTDB_id=1065787 ACH105_RS15855 WP_272890074.1 3372970..3373155(+) (pilV) [Stutzerimonas balearica strain Y11]
ATGAAATCCATCAAGAAGCAAAAAGGTTTCACGCTGATCGAACTGATGATCGTCGTAGCGATCATTGGCATTCTAGCTGC
GATCGCCATTCCACAATTCAACGAATATCGAGCCAAGGCGAACGACTCTACCGCACAAGCCGATGCCAAAAACATTCTAA
CAGTCATGGCTGCCGCTCAGCGCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	58.929	91.803	0.541
pilA	Acinetobacter nosocomialis M2	76.923	63.934	0.492
pilA2	Legionella pneumophila strain ERS1305867	65.217	75.41	0.492
pilA2	Legionella pneumophila str. Paris	65.217	75.41	0.492
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	53.571	91.803	0.492
pilA	Acinetobacter baumannii strain A118	85.294	55.738	0.475
pilA	Ralstonia pseudosolanacearum GMI1000	64.444	73.77	0.475
pilA	Vibrio campbellii strain DS40M4	77.778	59.016	0.459
pilA	Vibrio parahaemolyticus RIMD 2210633	56	81.967	0.459
pilA/pilA1	Eikenella corrodens VA1	75	59.016	0.443
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	75	59.016	0.443
pilA	Vibrio cholerae C6706	75	59.016	0.443
pilA	Vibrio cholerae strain A1552	75	59.016	0.443
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
comP	Acinetobacter baylyi ADP1	76.471	55.738	0.426
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	66.667	63.934	0.426
pilE	Neisseria gonorrhoeae MS11	66.667	63.934	0.426
pilE	Neisseria gonorrhoeae strain FA1090	66.667	63.934	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	74.286	57.377	0.426
comF	Acinetobacter baylyi ADP1	57.778	73.77	0.426
pilE	Acinetobacter baumannii D1279779	54.348	75.41	0.41
pilA	Haemophilus influenzae 86-028NP	70.588	55.738	0.393
pilA	Haemophilus influenzae Rd KW20	70.588	55.738	0.393
pilA/pilA4	Thermus thermophilus HB27	54.545	72.131	0.393
comE	Acinetobacter baylyi ADP1	54.545	72.131	0.393
pilA	Glaesserella parasuis strain SC1401	69.697	54.098	0.377
pilX	Neisseria meningitidis 8013	60.526	62.295	0.377
pilL	Neisseria gonorrhoeae MS11	60.526	62.295	0.377
pilA/pilA1	Synechocystis sp. PCC 6803	51.163	70.492	0.361