Detailed information
Overview
| Name | pilA | Type | Machinery gene |
| Locus tag | P1P91_RS08805 | Genome accession | NZ_CP119391 |
| Coordinates | 1874370..1874501 (-) | Length | 43 a.a. |
| NCBI ID | WP_311885756.1 | Uniprot ID | - |
| Organism | Halomonas piscis strain SG2L-4 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1866822..1875019 | 1874370..1874501 | within | 0 |
Gene organization within MGE regions
Location: 1866822..1875019
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1P91_RS08765 (P1P91_08755) | - | 1867079..1867852 (-) | 774 | WP_311882012.1 | IS110 family transposase | - |
| P1P91_RS08770 (P1P91_08760) | - | 1868077..1868715 (-) | 639 | WP_311882014.1 | DUF2335 domain-containing protein | - |
| P1P91_RS08775 (P1P91_08765) | - | 1869127..1870506 (-) | 1380 | WP_311882016.1 | sigma-54 dependent transcriptional regulator | - |
| P1P91_RS08780 (P1P91_08770) | - | 1871443..1871721 (-) | 279 | WP_311882017.1 | transposase | - |
| P1P91_RS08785 (P1P91_08775) | - | 1872038..1872316 (-) | 279 | WP_311882017.1 | transposase | - |
| P1P91_RS08790 (P1P91_08780) | - | 1872633..1873667 (-) | 1035 | WP_311882018.1 | IS110 family transposase | - |
| P1P91_RS08800 (P1P91_08790) | - | 1874110..1874373 (-) | 264 | WP_311885754.1 | hypothetical protein | - |
| P1P91_RS08805 (P1P91_08795) | pilA | 1874370..1874501 (-) | 132 | WP_311885756.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| P1P91_RS08810 (P1P91_08800) | - | 1874564..1875019 (-) | 456 | WP_311882019.1 | pilin | - |
Sequence
Protein
Download Length: 43 a.a. Molecular weight: 4852.88 Da Isoelectric Point: 12.6293
>NTDB_id=798776 P1P91_RS08805 WP_311885756.1 1874370..1874501(-) (pilA) [Halomonas piscis strain SG2L-4]
MQSRQRGFTLIELMIVVAIIGVLAAVAIPRYRGHVARHRPAKR
MQSRQRGFTLIELMIVVAIIGVLAAVAIPRYRGHVARHRPAKR
Nucleotide
Download Length: 132 bp
>NTDB_id=798776 P1P91_RS08805 WP_311885756.1 1874370..1874501(-) (pilA) [Halomonas piscis strain SG2L-4]
ATGCAATCCAGGCAGCGCGGCTTTACCCTGATCGAGCTGATGATCGTTGTTGCCATTATCGGCGTGCTGGCCGCCGTGGC
CATTCCCCGGTATCGAGGCCACGTGGCCCGGCACAGGCCAGCGAAGCGCTGA
ATGCAATCCAGGCAGCGCGGCTTTACCCTGATCGAGCTGATGATCGTTGTTGCCATTATCGGCGTGCTGGCCGCCGTGGC
CATTCCCCGGTATCGAGGCCACGTGGCCCGGCACAGGCCAGCGAAGCGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.