NTDB

Overview

Name	comP	Type	Machinery gene
Locus tag	NMV_RS10945	Genome accession	NC_017501
Coordinates	2137938..2138387 (-)	Length	149 a.a.
NCBI ID	WP_002218144.1	Uniprot ID	-
Organism	Neisseria meningitidis 8013
Function	DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) DNA binding and uptake

Function

ComP is the main DNA receptor during transformation both in the presence and in the absence of DUS. In the comP mutant, although there was more than a 1,000-fold decrease in competence, few transformants were reproducibly obtained.

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2128693..2138774	2137938..2138387	within	0
IScluster/Tn	2136764..2137242	2137938..2138387	flank	696

Gene organization within MGE regions

Location: 2128693..2138774

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NMV_RS10905 (NMV_2208)	-	2128693..2129685 (+)	993	WP_014574273.1	DNA cytosine methyltransferase	-
NMV_RS10910 (NMV_2209)	-	2129790..2133200 (+)	3411	WP_048813560.1	DUF3418 domain-containing protein	-
NMV_RS10915 (NMV_2210)	-	2133223..2133645 (-)	423	WP_002214928.1	very short patch repair endonuclease	-
NMV_RS10920 (NMV_2211)	-	2133649..2135295 (-)	1647	WP_014574274.1	TIGR02391 family protein	-
NMV_RS10925 (NMV_2212)	-	2135309..2136364 (-)	1056	WP_002221681.1	DNA cytosine methyltransferase	-
NMV_RS10935	-	2136770..2137242 (-)	473	Protein_2049	transposase	-
NMV_RS16385 (NMV_2215)	-	2137580..2137848 (+)	269	Protein_2050	5'-nucleotidase	-
NMV_RS10945 (NMV_2216)	comP	2137938..2138387 (-)	450	WP_002218144.1	type IV pilin protein	Machinery gene

Sequence

Protein

Download Length: 149 a.a. Molecular weight: 16868.82 Da Isoelectric Point: 9.7951

                                >NTDB_id=1085 NMV_RS10945 WP_002218144.1 2137938..2138387(-) (comP) [Neisseria meningitidis 8013]

MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG

FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLFK

Nucleotide

Download Length: 450 bp

                                >NTDB_id=1085 NMV_RS10945 WP_002218144.1 2137938..2138387(-) (comP) [Neisseria meningitidis 8013]

ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA

TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG

AAAAGTTTTATCTGCAGAATGGGAGGTTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC

TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA

TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG

GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTATTTAAGTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-107)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comP	Neisseria gonorrhoeae MS11	99.329	100	0.993
comP	Neisseria subflava NJ9703	49.664	100	0.497

Multiple sequence alignment

References

[1]	Stian Aleksander Helsem et al. (2025) Two different and robustly modeled DNA binding modes of Competence Protein ComP - systematic modeling with AlphaFold 3, RoseTTAFold2NA, Chai-1 and re-docking in HADDOCK. PloS One 20(5):e0315160. [PMID: 40338866]
[2]	Jamie-Lee Berry et al. (2016) A Comparative Structure/Function Analysis of Two Type IV Pilin DNA Receptors Defines a Novel Mode of DNA Binding. Structure (London, England : 1993) 24(6):926-34. [PMID: 27161979]
[3]	Ana Cehovin et al. (2013) Specific DNA recognition mediated by a type IV pilin. Proceedings of The National Academy of Sciences of The United States of America 110(8):3065-70. [PMID: 23386723]
[4]	Jamie-Lee Berry et al. (2013) Functional analysis of the interdependence between DNA uptake sequence and its cognate ComP receptor during natural transformation in Neisseria species. PLoS Genetics 9(12):e1004014. [PMID: 24385921]
[5]	Ana Cehovin et al. (2011) Testing the vaccine potential of PilV, PilX and ComP, minor subunits of Neisseria meningitidis type IV pili. Vaccine 29(40):6858-65. [PMID: 21803096]
[6]	Daniel R Brown et al. (2010) Systematic functional analysis reveals that a set of seven genes is involved in fine-tuning of the multiple functions mediated by type IV pili in Neisseria meningitidis. Infection And Immunity 78(7):3053-63. [PMID: 20439474]

Detailed information NTG0001085