Detailed information    

experimental Experimentally validated

Overview


Name   comP   Type   Machinery gene
Locus tag   NMV_RS10945 Genome accession   NC_017501
Coordinates   2137938..2138387 (-) Length   149 a.a.
NCBI ID   WP_002218144.1    Uniprot ID   -
Organism   Neisseria meningitidis 8013     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS)   
DNA binding and uptake

Function


ComP is the main DNA receptor during transformation both in the presence and in the absence of DUS. In the comP mutant, although there was more than a 1,000-fold decrease in competence, few transformants were reproducibly obtained.


Genomic Context


Location: 2132938..2143387
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMV_RS10915 (NMV_2210) - 2133223..2133645 (-) 423 WP_002214928.1 very short patch repair endonuclease -
  NMV_RS10920 (NMV_2211) - 2133649..2135295 (-) 1647 WP_014574274.1 TIGR02391 family protein -
  NMV_RS10925 (NMV_2212) - 2135309..2136364 (-) 1056 WP_002221681.1 DNA cytosine methyltransferase -
  NMV_RS10935 - 2136770..2137242 (-) 473 Protein_2049 transposase -
  NMV_RS16385 (NMV_2215) - 2137580..2137848 (+) 269 Protein_2050 5'-nucleotidase -
  NMV_RS10945 (NMV_2216) comP 2137938..2138387 (-) 450 WP_002218144.1 type IV pilin protein Machinery gene
  NMV_RS15395 (NMV_2217) comE 2138475..2138939 (-) 465 WP_014574275.1 ComEA family DNA-binding protein Machinery gene

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16868.82 Da        Isoelectric Point: 9.7951

>NTDB_id=1085 NMV_RS10945 WP_002218144.1 2137938..2138387(-) (comP) [Neisseria meningitidis 8013]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLFK

Nucleotide


Download         Length: 450 bp        

>NTDB_id=1085 NMV_RS10945 WP_002218144.1 2137938..2138387(-) (comP) [Neisseria meningitidis 8013]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGGTTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTATTTAAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria gonorrhoeae MS11

99.329

100

0.993

  comP Neisseria subflava NJ9703

49.664

100

0.497


Multiple sequence alignment    



References


[1] Stian Aleksander Helsem et al. (2025) Two different and robustly modeled DNA binding modes of Competence Protein ComP - systematic modeling with AlphaFold 3, RoseTTAFold2NA, Chai-1 and re-docking in HADDOCK. PloS One 20(5):e0315160. [PMID: 40338866]
[2] Jamie-Lee Berry et al. (2016) A Comparative Structure/Function Analysis of Two Type IV Pilin DNA Receptors Defines a Novel Mode of DNA Binding. Structure (London, England : 1993) 24(6):926-34. [PMID: 27161979]
[3] Ana Cehovin et al. (2013) Specific DNA recognition mediated by a type IV pilin. Proceedings of The National Academy of Sciences of The United States of America 110(8):3065-70. [PMID: 23386723]
[4] Jamie-Lee Berry et al. (2013) Functional analysis of the interdependence between DNA uptake sequence and its cognate ComP receptor during natural transformation in Neisseria species. PLoS Genetics 9(12):e1004014. [PMID: 24385921]
[5] Ana Cehovin et al. (2011) Testing the vaccine potential of PilV, PilX and ComP, minor subunits of Neisseria meningitidis type IV pili. Vaccine 29(40):6858-65. [PMID: 21803096]
[6] Daniel R Brown et al. (2010) Systematic functional analysis reveals that a set of seven genes is involved in fine-tuning of the multiple functions mediated by type IV pili in Neisseria meningitidis. Infection And Immunity 78(7):3053-63. [PMID: 20439474]