Detailed information NTG0994318

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: AAG092_RS07470
• Genome accession: NZ_CP154874
• Coordinates: 1539321..1539503 (-)
• Length: 60 a.a.
• NCBI ID: WP_110680823.1
• Uniprot ID: -
• Organism: Pseudomonas alcaligenes strain Med1
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1536269..1545789	1539321..1539503	within	0

Gene organization within MGE regions

Location: 1536269..1545789

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AAG092_RS07450 (AAG092_07400)	-	1536269..1537162 (-)	894	WP_373389177.1	ABC transporter ATP-binding protein	-
AAG092_RS07455 (AAG092_07405)	-	1537159..1537995 (-)	837	WP_110680826.1	hypothetical protein	-
AAG092_RS07460 (AAG092_07410)	-	1537992..1538789 (-)	798	WP_110680825.1	ABC transporter permease subunit	-
AAG092_RS07465 (AAG092_07415)	-	1538861..1539301 (-)	441	WP_110680824.1	hypothetical protein	-
AAG092_RS07470 (AAG092_07420)	pilA	1539321..1539503 (-)	183	WP_110680823.1	type IV pilin protein	Machinery gene
AAG092_RS07475 (AAG092_07425)	pilB	1539749..1541455 (+)	1707	WP_373389568.1	type IV-A pilus assembly ATPase PilB	Machinery gene
AAG092_RS07480 (AAG092_07430)	pilC	1541462..1542685 (+)	1224	WP_110680822.1	type II secretion system F family protein	Machinery gene
AAG092_RS07485 (AAG092_07435)	pilD	1542685..1543557 (+)	873	WP_373389178.1	A24 family peptidase	Machinery gene
AAG092_RS07490 (AAG092_07440)	coaE	1543554..1544165 (+)	612	WP_373389179.1	dephospho-CoA kinase	-
AAG092_RS07495 (AAG092_07445)	yacG	1544162..1544356 (+)	195	WP_110680819.1	DNA gyrase inhibitor YacG	-
AAG092_RS07500 (AAG092_07450)	-	1544360..1544575 (-)	216	WP_373389180.1	hypothetical protein	-
AAG092_RS07505 (AAG092_07455)	-	1544681..1545367 (-)	687	WP_373389181.1	energy-coupling factor ABC transporter permease	-
AAG092_RS07510 (AAG092_07460)	-	1545364..1545789 (-)	426	WP_373389182.1	GNAT family N-acetyltransferase	-

Sequence

Protein

• Length: 60 a.a.
• Molecular weight: 6425.51 Da
• Isoelectric Point: 9.7375

>NTDB_id=994318 AAG092_RS07470 WP_110680823.1 1539321..1539503(-) (pilA) [Pseudomonas alcaligenes strain Med1]
MSKKVQKGFTLIELMIVVAIIGILAAVAIPQFQDYQAKGYDKSAQSDARNILTGAIANSN

Nucleotide

• Length: 183 bp

>NTDB_id=994318 AAG092_RS07470 WP_110680823.1 1539321..1539503(-) (pilA) [Pseudomonas alcaligenes strain Med1]
ATGTCGAAGAAAGTTCAGAAGGGCTTTACCCTCATCGAACTGATGATCGTGGTTGCGATCATCGGTATTCTCGCGGCCGT
TGCCATTCCGCAGTTCCAGGACTATCAGGCTAAAGGCTATGACAAGTCGGCTCAGTCCGATGCTCGTAACATCCTGACCG
GCGCCATCGCCAACTCGAACTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (4-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter baumannii strain A118	69.388	81.667	0.567
pilA	Ralstonia pseudosolanacearum GMI1000	60.377	88.333	0.533
pilA	Pseudomonas aeruginosa PAK	75.61	68.333	0.517
pilA/pilA1	Eikenella corrodens VA1	78.947	63.333	0.5
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	56.863	85	0.483
pilA	Vibrio campbellii strain DS40M4	75.676	61.667	0.467
pilA	Vibrio parahaemolyticus RIMD 2210633	52.83	88.333	0.467
pilA	Acinetobacter nosocomialis M2	84.848	55	0.467
pilA/pilAI	Pseudomonas stutzeri DSM 10701	71.053	63.333	0.45
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	77.143	58.333	0.45
pilA	Vibrio cholerae C6706	77.143	58.333	0.45
pilA	Vibrio cholerae strain A1552	77.143	58.333	0.45
pilA2	Legionella pneumophila strain ERS1305867	90	50	0.45
pilA2	Legionella pneumophila str. Paris	81.818	55	0.45
pilE	Neisseria gonorrhoeae MS11	76.471	56.667	0.433
pilE	Neisseria gonorrhoeae strain FA1090	76.471	56.667	0.433
comF	Acinetobacter baylyi ADP1	59.091	73.333	0.433
pilE	Acinetobacter baumannii D1279779	55.319	78.333	0.433
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	72.222	60	0.433
comP	Acinetobacter baylyi ADP1	75.758	55	0.417
pilA/pilAII	Pseudomonas stutzeri DSM 10701	59.524	70	0.417
pilL	Neisseria gonorrhoeae MS11	68.571	58.333	0.4
pilX	Neisseria meningitidis 8013	68.571	58.333	0.4
pilA	Haemophilus influenzae 86-028NP	63.889	60	0.383
pilA	Haemophilus influenzae Rd KW20	67.647	56.667	0.383