Detailed information NTG0913588

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: U3Q39_RS04780
• Genome accession: NZ_CP140298
• Coordinates: 1003816..1004001 (-)
• Length: 61 a.a.
• NCBI ID: WP_170799083.1
• Uniprot ID: -
• Organism: Stutzerimonas stutzeri strain MJL19
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 998816..1009001

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
U3Q39_RS04765 (U3Q39_004765)	-	1000652..1001548 (-)	897	WP_170799081.1	ABC transporter ATP-binding protein	-
U3Q39_RS04770 (U3Q39_004770)	-	1001545..1002171 (-)	627	WP_170799082.1	hypothetical protein	-
U3Q39_RS04775 (U3Q39_004775)	-	1002383..1003183 (-)	801	WP_241694827.1	hypothetical protein	-
U3Q39_RS04780 (U3Q39_004780)	pilA	1003816..1004001 (-)	186	WP_170799083.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
U3Q39_RS04785 (U3Q39_004785)	pilB	1004437..1006140 (+)	1704	WP_170799084.1	type IV-A pilus assembly ATPase PilB	Machinery gene
U3Q39_RS04790 (U3Q39_004790)	pilC	1006143..1007360 (+)	1218	WP_095460666.1	type II secretion system F family protein	Machinery gene
U3Q39_RS04795 (U3Q39_004795)	pilD	1007366..1008232 (+)	867	WP_170799085.1	prepilin peptidase	Machinery gene
U3Q39_RS04800 (U3Q39_004800)	coaE	1008364..1008972 (+)	609	WP_170799086.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6622.94 Da
• Isoelectric Point: 10.5719

>NTDB_id=913588 U3Q39_RS04780 WP_170799083.1 1003816..1004001(-) (pilA) [Stutzerimonas stutzeri strain MJL19]
MKSIKKQKGFTLIELMIVIAIIGILAAIAIPQFNDYRAKANDSTALADVKNAITMFAAAQR

Nucleotide

• Length: 186 bp

>NTDB_id=913588 U3Q39_RS04780 WP_170799083.1 1003816..1004001(-) (pilA) [Stutzerimonas stutzeri strain MJL19]
ATGAAGTCCATCAAGAAGCAAAAAGGTTTTACCTTAATCGAACTTATGATCGTGATCGCGATCATCGGAATTCTGGCTGC
TATTGCTATTCCGCAGTTCAACGATTATCGAGCCAAGGCTAACGATTCCACCGCCCTTGCTGATGTTAAAAACGCAATCA
CCATGTTTGCTGCAGCGCAACGCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	69.565	75.41	0.525
pilA	Acinetobacter nosocomialis M2	72.727	72.131	0.525
pilA	Ralstonia pseudosolanacearum GMI1000	59.259	88.525	0.525
pilE	Neisseria gonorrhoeae strain FA1090	58.491	86.885	0.508
pilE	Neisseria gonorrhoeae MS11	58.491	86.885	0.508
pilA2	Legionella pneumophila str. Paris	68.889	73.77	0.508
pilA2	Legionella pneumophila strain ERS1305867	68.889	73.77	0.508
pilA	Acinetobacter baumannii strain A118	56.604	86.885	0.492
pilA	Vibrio parahaemolyticus RIMD 2210633	60	81.967	0.492
pilA/pilAII	Pseudomonas stutzeri DSM 10701	50	98.361	0.492
comP	Acinetobacter baylyi ADP1	75	65.574	0.492
pilA/pilA1	Eikenella corrodens VA1	80.556	59.016	0.475
pilA/pilAI	Pseudomonas stutzeri DSM 10701	67.442	70.492	0.475
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	72.5	65.574	0.475
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	61.702	77.049	0.475
pilA	Vibrio campbellii strain DS40M4	77.778	59.016	0.459
pilA	Vibrio cholerae C6706	62.222	73.77	0.459
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	62.222	73.77	0.459
pilA	Vibrio cholerae strain A1552	62.222	73.77	0.459
pilA/pilA4	Thermus thermophilus HB27	52	81.967	0.426
pilA	Haemophilus influenzae 86-028NP	73.529	55.738	0.41
pilA	Haemophilus influenzae Rd KW20	73.529	55.738	0.41
pilX	Neisseria meningitidis 8013	46.296	88.525	0.41
pilL	Neisseria gonorrhoeae MS11	46.296	88.525	0.41
comF	Acinetobacter baylyi ADP1	60	65.574	0.393
pilA	Glaesserella parasuis strain SC1401	72.727	54.098	0.393