Detailed information NTG0909430

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: SMG00_RS05100
• Genome accession: NZ_CP139417
• Coordinates: 1099463..1099648 (-)
• Length: 61 a.a.
• NCBI ID: WP_279647682.1
• Uniprot ID: -
• Organism: Stutzerimonas stutzeri strain H46
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1094463..1104648

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMG00_RS05080	-	1096004..1096900 (-)	897	WP_279647687.1	ABC transporter ATP-binding protein	-
SMG00_RS05085	-	1096897..1097667 (-)	771	WP_279647686.1	hypothetical protein	-
SMG00_RS05090	-	1097735..1098535 (-)	801	WP_279647685.1	ABC transporter permease	-
SMG00_RS22055	-	1098771..1098914 (-)	144	WP_407834998.1	Tfp structural protein	-
SMG00_RS05095	-	1098999..1099442 (-)	444	WP_279647683.1	hypothetical protein	-
SMG00_RS05100	pilA	1099463..1099648 (-)	186	WP_279647682.1	type IV pilin protein	Machinery gene
SMG00_RS05105	pilB	1100017..1101720 (+)	1704	WP_279647681.1	type IV-A pilus assembly ATPase PilB	Machinery gene
SMG00_RS05110	pilC	1101723..1102943 (+)	1221	WP_019405597.1	type II secretion system F family protein	Machinery gene
SMG00_RS05115	pilD	1102947..1103813 (+)	867	WP_320893267.1	A24 family peptidase	Machinery gene
SMG00_RS05120	coaE	1103945..1104553 (+)	609	WP_080940987.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6633.92 Da
• Isoelectric Point: 10.2806

>NTDB_id=909430 SMG00_RS05100 WP_279647682.1 1099463..1099648(-) (pilA) [Stutzerimonas stutzeri strain H46]
MKSIKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKSNDTVAQADVKNNISVMTAAQL

Nucleotide

• Length: 186 bp

>NTDB_id=909430 SMG00_RS05100 WP_279647682.1 1099463..1099648(-) (pilA) [Stutzerimonas stutzeri strain H46]
ATGAAGTCCATCAAGAAGCAAAAAGGTTTTACACTCATCGAACTGATGATTGTGGTTGCCATCATTGGCATTCTGGCTGC
TATCGCCATTCCACAGTTCAACGAGTATCGCGCAAAGTCGAACGATACTGTTGCCCAAGCAGACGTGAAAAATAATATTA
GCGTCATGACTGCCGCTCAGCTTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Vibrio cholerae strain A1552	63.462	85.246	0.541
pilA	Vibrio cholerae C6706	63.462	85.246	0.541
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	63.462	85.246	0.541
pilA	Vibrio parahaemolyticus RIMD 2210633	57.895	93.443	0.541
pilA	Pseudomonas aeruginosa PAK	71.739	75.41	0.541
comP	Acinetobacter baylyi ADP1	60.784	83.607	0.508
pilA2	Legionella pneumophila strain ERS1305867	66.667	73.77	0.492
pilA2	Legionella pneumophila str. Paris	66.667	73.77	0.492
pilA	Acinetobacter baumannii strain A118	88.235	55.738	0.492
pilA	Ralstonia pseudosolanacearum GMI1000	60.417	78.689	0.475
pilA/pilAI	Pseudomonas stutzeri DSM 10701	67.442	70.492	0.475
pilA	Acinetobacter nosocomialis M2	85.294	55.738	0.475
pilA/pilAII	Pseudomonas stutzeri DSM 10701	56	81.967	0.459
pilA/pilA1	Eikenella corrodens VA1	69.231	63.934	0.443
pilA	Vibrio campbellii strain DS40M4	75	59.016	0.443
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	59.091	72.131	0.426
pilE	Acinetobacter baumannii D1279779	55.556	73.77	0.41
comF	Acinetobacter baylyi ADP1	54.348	75.41	0.41
comE	Acinetobacter baylyi ADP1	54.348	75.41	0.41
pilA/pilA4	Thermus thermophilus HB27	56.818	72.131	0.41
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	73.529	55.738	0.41
pilE	Neisseria gonorrhoeae strain FA1090	67.647	55.738	0.377
pilA	Haemophilus influenzae 86-028NP	67.647	55.738	0.377
pilA	Haemophilus influenzae Rd KW20	67.647	55.738	0.377
pilE	Neisseria gonorrhoeae MS11	67.647	55.738	0.377
pilA/pilA1	Synechocystis sp. PCC 6803	41.071	91.803	0.377
pilA	Glaesserella parasuis strain SC1401	66.667	54.098	0.361