Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | BSU_34540 | Genome accession | NC_000964 |
| Coordinates | 3546234..3546827 (+) | Length | 197 a.a. |
| NCBI ID | NP_391334.1 | Uniprot ID | P80244 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | degradation of ComK; degradation of DegU Competence regulation |
||
Genomic Context
Location: 3541234..3551827
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_34490 (BSU34490) | psmA | 3541488..3541823 (+) | 336 | NP_391329.1 | sodium / proton antiporter subunit A | - |
| BSU_34500 (BSU34500) | psmB | 3541823..3542143 (+) | 321 | NP_391330.1 | sodium-proton two component antiporter subunit | - |
| BSU_34510 (BSU34510) | yvdQ | 3542179..3542691 (-) | 513 | NP_391331.1 | hypothetical protein | - |
| BSU_34520 (BSU34520) | cotNP | 3542943..3544286 (-) | 1344 | NP_391332.1 | spore coat protein; putative oxidoreductase | - |
| BSU_34530 (BSU34530) | cotR | 3544642..3545604 (+) | 963 | NP_391333.1 | spore coat lipolytic enzyme | - |
| BSU_34540 (BSU34540) | clpP | 3546234..3546827 (+) | 594 | NP_391334.1 | ATP-dependent Clp protease proteolytic subunit; Maxwell's demon | Regulator |
| BSU_34550 (BSU34550) | mdxM | 3546873..3547553 (-) | 681 | NP_391335.1 | bifunctional beta-phosphoglucomutase / glucose-1-phosphate phosphodismutase | - |
| BSU_34560 (BSU34560) | mdxL | 3547550..3549235 (-) | 1686 | NP_391336.1 | oligo-1,4-1,6-alpha-glucosidase (sucrase-maltase-isomaltase) | - |
| BSU_34570 (BSU34570) | mdxK | 3549228..3551501 (-) | 2274 | NP_391337.1 | maltose phosphorylase | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| clpP | comK | negative effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416
>NTDB_id=86 BSU_34540 NP_391334.1 3546234..3546827(+) (clpP) [Bacillus subtilis subsp. subtilis str. 168]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ
PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ
PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK
Nucleotide
Download Length: 594 bp
>NTDB_id=86 BSU_34540 NP_391334.1 3546234..3546827(+) (clpP) [Bacillus subtilis subsp. subtilis str. 168]
ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA
TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG
AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC
ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG
CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA
CAGAAATTGAAATTGCTGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTAGCTGAACGTACTGGCCAG
CCGCTTGAAGTGATCGAACGCGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA
CAAAATTTTGACTCACACAGAAGACAAAAAGTAA
ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA
TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG
AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC
ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG
CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA
CAGAAATTGAAATTGCTGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTAGCTGAACGTACTGGCCAG
CCGCTTGAAGTGATCGAACGCGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA
CAAAATTTTGACTCACACAGAAGACAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
68.617 |
96.907 |
0.665 |
| clpP | Streptococcus thermophilus LMD-9 |
59.184 |
100 |
0.592 |
| clpP | Streptococcus thermophilus LMG 18311 |
59.184 |
100 |
0.592 |
| clpP | Streptococcus pneumoniae D39 |
58.854 |
97.959 |
0.577 |
| clpP | Streptococcus pneumoniae Rx1 |
58.854 |
97.959 |
0.577 |
| clpP | Streptococcus pneumoniae TIGR4 |
58.854 |
97.959 |
0.577 |
| clpP | Streptococcus pneumoniae R6 |
58.854 |
97.959 |
0.577 |
| clpP | Streptococcus pyogenes JRS4 |
57.143 |
100 |
0.571 |
| clpP | Streptococcus pyogenes MGAS315 |
57.143 |
100 |
0.571 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
57.895 |
96.447 |
0.558 |
| clpP | Streptococcus mutans UA159 |
54.822 |
100 |
0.548 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
57.368 |
95.477 |
0.548 |
Multiple sequence alignment
References
| [1] | Denise Dittmar et al. (2020) Complementation studies with human ClpP in Bacillus subtilis. Biochimica Et Biophysica Acta. Molecular Cell Research 1867(9):118744. [PMID: 32442436] |
| [2] | Byung-Gil Lee et al. (2011) Structural insights into the conformational diversity of ClpP from Bacillus subtilis. Molecules And Cells 32(6):589-95. [PMID: 22080375] |
| [3] | Mitsuo Ogura et al. (2010) Autoregulation of the Bacillus subtilis response regulator gene degU is coupled with the proteolysis of DegU-P by ClpCP. Molecular Microbiology 75(5):1244-59. [PMID: 20070525] |
| [4] | T Msadek et al. (1998) ClpP of Bacillus subtilis is required for competence development, motility, degradative enzyme synthesis, growth at high temperature and sporulation. Molecular Microbiology 27(5):899-914. [PMID: 9535081] |
| [5] | K Turgay et al. (1997) Biochemical characterization of a molecular switch involving the heat shock protein ClpC, which controls the activity of ComK, the competence transcription factor of Bacillus subtilis. Genes & Development 11(1):119-28. [PMID: 9000055] |
| [6] | L Kong et al. (1994) Regulation of competence-specific gene expression by Mec-mediated protein-protein interaction in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 91(13):5793-7. [PMID: 8016067] |