Detailed information NTG0000090

Experimentally validated

Overview

• Name: comA
• Type: Regulator
• Locus tag: BSU_31680
• Genome accession: NC_000964
• Coordinates: 3252804..3253448 (-)
• Length: 214 a.a.
• NCBI ID: NP_391046.1
• Uniprot ID: P14204
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: promoting transcription of comS Competence regulation

Function

ComA, when phosphorylated by ComP, binds to the promoter region of the srfA operon, which includes comS, thereby promoting its transcription. ComS then stabilizes ComK, the master regulator of competence.

Genomic Context

Location: 3247804..3258448

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_31610 (BSU31610)	mrpB	3248996..3249427 (+)	432	NP_391039.1	Na+/H+ antiporter complex	-
BSU_31620 (BSU31620)	mrpC	3249427..3249768 (+)	342	NP_391040.2	component of Na+/H+ antiporter	-
BSU_31630 (BSU31630)	mrpD	3249761..3251242 (+)	1482	NP_391041.3	proton transporter component of Na+/H+ antiporter	-
BSU_31640 (BSU31640)	mrpE	3251248..3251724 (+)	477	YP_054591.2	non essential component of Na+/H+ antiporter	-
BSU_31650 (BSU31650)	mrpF	3251724..3252008 (+)	285	NP_391043.2	efflux transporter for Na+ and cholate	-
BSU_31660 (BSU31660)	mrpG	3251992..3252366 (+)	375	NP_391044.1	non essential component of Na+/H+ antiporter	-
BSU_31670 (BSU31670)	yuxO	3252405..3252785 (-)	381	NP_391045.2	putative proofreading thioesterase in bacillibactin biosynthesis	-
BSU_31680 (BSU31680)	comA	3252804..3253448 (-)	645	NP_391046.1	two-component response quorum-sensing regulator	Regulator
BSU_31690 (BSU31690)	comP	3253529..3255838 (-)	2310	NP_391047.2	two-component sensor histidine kinase	Regulator
BSU_31700 (BSU31700)	comX	3255853..3256020 (-)	168	NP_391048.1	competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified)	Regulator
BSU_31710 (BSU31710)	comQ	3256008..3256907 (-)	900	NP_391049.2	isoprenyl transferase (pre-ComX modification)	Regulator
BSU_31720 (BSU31720)	degQ	3257092..3257232 (-)	141	NP_391050.1	pleiotropic regulator	Regulator
BSU_31725 (BSU31725)	-	3257454..3257579 (+)	126	YP_009514001.1	hypothetical protein	-
BSU_31730 (BSU31730)	cotIC	3257693..3258061 (+)	369	NP_391051.2	inner spore coat protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comA	comS	positive effect
comS	comK	positive effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
spo0A	comK	positive effect
rok	comK	negative effect
degU	comK	positive effect
clpC	comK	negative effect
med	comK	positive effect
spo0A	comK	negative effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 214 a.a.
• Molecular weight: 24128.51 Da
• Isoelectric Point: 4.6857

>NTDB_id=90 BSU_31680 NP_391046.1 3252804..3253448(-) (comA) [Bacillus subtilis subsp. subtilis str. 168]
MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGGEVNGMELSKQILQENPHCKI
IVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECL
ILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL

Nucleotide

• Length: 645 bp

>NTDB_id=90 BSU_31680 NP_391046.1 3252804..3253448(-) (comA) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAAAAGATACTAGTGATTGATGACCATCCGGCTGTCATGGAAGGCACCAAGACAATTTTGGAAACGGATTCGAATTT
GTCTGTTGATTGTCTCAGTCCTGAACCGAGCGAACAGTTTATCAAGCAGCATGATTTCTCGTCATATGATCTCATTTTAA
TGGATCTGAATCTAGGCGGCGAGGTCAATGGGATGGAGCTTTCTAAACAGATTTTACAAGAGAATCCTCATTGTAAAATT
ATCGTGTATACCGGTTATGAGGTCGAGGATTATTTCGAGGAAGCGATTCGTGCGGGTCTGCACGGTGCCATCAGCAAAAC
GGAATCTAAAGAAAAGATCACCCAATACATATACCACGTACTCAACGGAGAAATTTTAGTCGATTTTGCTTACTTTAAAC
AGCTGATGACTCAGCAAAAAACAAAGCCGGCTCCTTCCTCTCAAAAAGAACAAGATGTGCTCACACCTAGAGAATGCCTG
ATTCTTCAAGAAGTTGAAAAGGGATTTACAAACCAAGAAATCGCAGATGCCCTTCATTTAAGCAAGCGGTCCATTGAATA
CAGCTTGACATCGATTTTCAATAAGCTGAATGTCGGTTCACGGACGGAAGCGGTTTTGATTGCGAAATCAGACGGTGTAC
TTTAA

Domains

Predicted by InterproScan.

• Bacterial regulatory proteins, luxR family (GerE) (152-208)

• Response regulator receiver domain (Response_reg) (4-117)

3D structure

• PDB: 2KRF
• PDB: 3ULQ

References

• [1]: Diana Wolf et al. (2016) The quorum-sensing regulator ComA from Bacillus subtilis activates transcription using topologically distinct DNA motifs. Nucleic Acids Research 44(5):2160-72. [PMID: 26582911]
• [2]: Xiaoyu Wang et al. (2010) Three non-aspartate amino acid mutations in the ComA Response regulator receiver motif severely decrease surfactin production, competence development and spore formation in Bacillus subtilis. Journal of Microbiology And Biotechnology 20(2):301-10. [PMID: 20208433]
• [3]: Cristina Bongiorni et al. (2005) Synergistic regulation of competence development in Bacillus subtilis by two Rap-Phr systems. Journal of Bacteriology 187(13):4353-61. [PMID: 15968044]
• [4]: Leighton Core et al. (2003) TPR-mediated interaction of RapC with ComA inhibits response regulator-DNA binding for competence development in Bacillus subtilis. Molecular Microbiology 49(6):1509-22. [PMID: 12950917]
• [5]: S B Kim et al. (2001) Involvement of acetyl phosphate in the in vivo activation of the response regulator ComA in Bacillus subtilis. FEMS Microbiology Letters 195(2):179-83. [PMID: 11179649]
• [6]: L S Tran et al. (2000) Divergent structure of the ComQXPA quorum-sensing components: molecular basis of strain-specific communication mechanism in Bacillus subtilis. Molecular Microbiology 37(5):1159-71. [PMID: 10972833]
• [7]: M Roggiani et al. (1993) ComA, a phosphorylated response regulator protein of Bacillus subtilis, binds to the promoter region of srfA. Journal of Bacteriology 175(10):3182-7. [PMID: 8387999]
• [8]: M M Nakano et al. (1991) The primary role of comA in establishment of the competent state in Bacillus subtilis is to activate expression of srfA. Journal of Bacteriology 173(22):7269-74. [PMID: 1938921]
• [9]: J Hahn et al. (1991) Growth stage signal transduction and the requirements for srfA induction in development of competence. Journal of Bacteriology 173(22):7275-82. [PMID: 1938922]