Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | BSU_31680 | Genome accession | NC_000964 |
| Coordinates | 3252804..3253448 (-) | Length | 214 a.a. |
| NCBI ID | NP_391046.1 | Uniprot ID | P14204 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | promoting transcription of comS Competence regulation |
||
Genomic Context
Location: 3247804..3258448
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_31610 (BSU31610) | mrpB | 3248996..3249427 (+) | 432 | NP_391039.1 | Na+/H+ antiporter complex | - |
| BSU_31620 (BSU31620) | mrpC | 3249427..3249768 (+) | 342 | NP_391040.2 | component of Na+/H+ antiporter | - |
| BSU_31630 (BSU31630) | mrpD | 3249761..3251242 (+) | 1482 | NP_391041.3 | proton transporter component of Na+/H+ antiporter | - |
| BSU_31640 (BSU31640) | mrpE | 3251248..3251724 (+) | 477 | YP_054591.2 | non essential component of Na+/H+ antiporter | - |
| BSU_31650 (BSU31650) | mrpF | 3251724..3252008 (+) | 285 | NP_391043.2 | efflux transporter for Na+ and cholate | - |
| BSU_31660 (BSU31660) | mrpG | 3251992..3252366 (+) | 375 | NP_391044.1 | non essential component of Na+/H+ antiporter | - |
| BSU_31670 (BSU31670) | yuxO | 3252405..3252785 (-) | 381 | NP_391045.2 | putative proofreading thioesterase in bacillibactin biosynthesis | - |
| BSU_31680 (BSU31680) | comA | 3252804..3253448 (-) | 645 | NP_391046.1 | two-component response quorum-sensing regulator | Regulator |
| BSU_31690 (BSU31690) | comP | 3253529..3255838 (-) | 2310 | NP_391047.2 | two-component sensor histidine kinase | Regulator |
| BSU_31700 (BSU31700) | comX | 3255853..3256020 (-) | 168 | NP_391048.1 | competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified) | Regulator |
| BSU_31710 (BSU31710) | comQ | 3256008..3256907 (-) | 900 | NP_391049.2 | isoprenyl transferase (pre-ComX modification) | Regulator |
| BSU_31720 (BSU31720) | degQ | 3257092..3257232 (-) | 141 | NP_391050.1 | pleiotropic regulator | Regulator |
| BSU_31725 (BSU31725) | - | 3257454..3257579 (+) | 126 | YP_009514001.1 | hypothetical protein | - |
| BSU_31730 (BSU31730) | cotIC | 3257693..3258061 (+) | 369 | NP_391051.2 | inner spore coat protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| comA | comS | positive effect |
| comS | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 214 a.a. Molecular weight: 24128.51 Da Isoelectric Point: 4.6857
>NTDB_id=90 BSU_31680 NP_391046.1 3252804..3253448(-) (comA) [Bacillus subtilis subsp. subtilis str. 168]
MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGGEVNGMELSKQILQENPHCKI
IVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECL
ILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGGEVNGMELSKQILQENPHCKI
IVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECL
ILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL
Nucleotide
Download Length: 645 bp
>NTDB_id=90 BSU_31680 NP_391046.1 3252804..3253448(-) (comA) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAAAAGATACTAGTGATTGATGACCATCCGGCTGTCATGGAAGGCACCAAGACAATTTTGGAAACGGATTCGAATTT
GTCTGTTGATTGTCTCAGTCCTGAACCGAGCGAACAGTTTATCAAGCAGCATGATTTCTCGTCATATGATCTCATTTTAA
TGGATCTGAATCTAGGCGGCGAGGTCAATGGGATGGAGCTTTCTAAACAGATTTTACAAGAGAATCCTCATTGTAAAATT
ATCGTGTATACCGGTTATGAGGTCGAGGATTATTTCGAGGAAGCGATTCGTGCGGGTCTGCACGGTGCCATCAGCAAAAC
GGAATCTAAAGAAAAGATCACCCAATACATATACCACGTACTCAACGGAGAAATTTTAGTCGATTTTGCTTACTTTAAAC
AGCTGATGACTCAGCAAAAAACAAAGCCGGCTCCTTCCTCTCAAAAAGAACAAGATGTGCTCACACCTAGAGAATGCCTG
ATTCTTCAAGAAGTTGAAAAGGGATTTACAAACCAAGAAATCGCAGATGCCCTTCATTTAAGCAAGCGGTCCATTGAATA
CAGCTTGACATCGATTTTCAATAAGCTGAATGTCGGTTCACGGACGGAAGCGGTTTTGATTGCGAAATCAGACGGTGTAC
TTTAA
ATGAAAAAGATACTAGTGATTGATGACCATCCGGCTGTCATGGAAGGCACCAAGACAATTTTGGAAACGGATTCGAATTT
GTCTGTTGATTGTCTCAGTCCTGAACCGAGCGAACAGTTTATCAAGCAGCATGATTTCTCGTCATATGATCTCATTTTAA
TGGATCTGAATCTAGGCGGCGAGGTCAATGGGATGGAGCTTTCTAAACAGATTTTACAAGAGAATCCTCATTGTAAAATT
ATCGTGTATACCGGTTATGAGGTCGAGGATTATTTCGAGGAAGCGATTCGTGCGGGTCTGCACGGTGCCATCAGCAAAAC
GGAATCTAAAGAAAAGATCACCCAATACATATACCACGTACTCAACGGAGAAATTTTAGTCGATTTTGCTTACTTTAAAC
AGCTGATGACTCAGCAAAAAACAAAGCCGGCTCCTTCCTCTCAAAAAGAACAAGATGTGCTCACACCTAGAGAATGCCTG
ATTCTTCAAGAAGTTGAAAAGGGATTTACAAACCAAGAAATCGCAGATGCCCTTCATTTAAGCAAGCGGTCCATTGAATA
CAGCTTGACATCGATTTTCAATAAGCTGAATGTCGGTTCACGGACGGAAGCGGTTTTGATTGCGAAATCAGACGGTGTAC
TTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Diana Wolf et al. (2016) The quorum-sensing regulator ComA from Bacillus subtilis activates transcription using topologically distinct DNA motifs. Nucleic Acids Research 44(5):2160-72. [PMID: 26582911] |
| [2] | Xiaoyu Wang et al. (2010) Three non-aspartate amino acid mutations in the ComA Response regulator receiver motif severely decrease surfactin production, competence development and spore formation in Bacillus subtilis. Journal of Microbiology And Biotechnology 20(2):301-10. [PMID: 20208433] |
| [3] | Cristina Bongiorni et al. (2005) Synergistic regulation of competence development in Bacillus subtilis by two Rap-Phr systems. Journal of Bacteriology 187(13):4353-61. [PMID: 15968044] |
| [4] | Leighton Core et al. (2003) TPR-mediated interaction of RapC with ComA inhibits response regulator-DNA binding for competence development in Bacillus subtilis. Molecular Microbiology 49(6):1509-22. [PMID: 12950917] |
| [5] | S B Kim et al. (2001) Involvement of acetyl phosphate in the in vivo activation of the response regulator ComA in Bacillus subtilis. FEMS Microbiology Letters 195(2):179-83. [PMID: 11179649] |
| [6] | L S Tran et al. (2000) Divergent structure of the ComQXPA quorum-sensing components: molecular basis of strain-specific communication mechanism in Bacillus subtilis. Molecular Microbiology 37(5):1159-71. [PMID: 10972833] |
| [7] | M Roggiani et al. (1993) ComA, a phosphorylated response regulator protein of Bacillus subtilis, binds to the promoter region of srfA. Journal of Bacteriology 175(10):3182-7. [PMID: 8387999] |
| [8] | M M Nakano et al. (1991) The primary role of comA in establishment of the competent state in Bacillus subtilis is to activate expression of srfA. Journal of Bacteriology 173(22):7269-74. [PMID: 1938921] |
| [9] | J Hahn et al. (1991) Growth stage signal transduction and the requirements for srfA induction in development of competence. Journal of Bacteriology 173(22):7275-82. [PMID: 1938922] |