Detailed information
Overview
| Name | comK | Type | Regulator |
| Locus tag | BSU_10420 | Genome accession | NC_000964 |
| Coordinates | 1117109..1117687 (+) | Length | 192 a.a. |
| NCBI ID | NP_388923.1 | Uniprot ID | P40396 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | activate transcription of late competence genes Competence regulation |
||
Function
In the natural transformation process of Bacillus subtilis, the comK gene encodes a competence transcription factor that serves as the master regulator of competence development. ComK is essential for the transcription of late competence genes, including those involved in DNA binding, uptake, and recombination (e.g., comC, comE, comF, comG, addAB, and recA). It also positively regulates its own expression through an autoregulatory loop. ComK acts as a key regulatory protein that integrates various signaling pathways and controls the transition to the competence state, enabling cells to bind and internalize transforming DNA. It binds specifically to the promoter regions of competence-related genes, activating their transcription and facilitating the assembly of the DNA uptake machinery.
Genomic Context
Location: 1112109..1122687
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_10380 (BSU10380) | hemAT | 1112620..1113918 (-) | 1299 | NP_388919.1 | heme-based dioxygen sensor | - |
| BSU_10390 (BSU10390) | yhfW | 1114057..1115586 (-) | 1530 | NP_388920.1 | putative oxidoreductase with Rieske [2Fe-2S] center | Unclear |
| BSU_10400 (BSU10400) | yhxC | 1115698..1116555 (+) | 858 | NP_388921.1 | putative oxidoreductase | Unclear |
| BSU_10410 (BSU10410) | yhzC | 1116583..1116816 (-) | 234 | NP_388922.1 | hypothetical protein | - |
| BSU_10420 (BSU10420) | comK | 1117109..1117687 (+) | 579 | NP_388923.1 | competence transcription factor (CTF) | Regulator |
| BSU_10430 (BSU10430) | yhxD | 1117734..1118633 (-) | 900 | NP_388924.1 | putative oxidoreductase | - |
| BSU_10440 (BSU10440) | yhjA | 1118850..1119119 (+) | 270 | NP_388925.1 | hypothetical protein | - |
| BSU_10450 (BSU10450) | yhjB | 1119162..1120631 (-) | 1470 | NP_388926.1 | putative Na+/metabolite cotransporter | - |
| BSU_10460 (BSU10460) | yhjC | 1120628..1120828 (-) | 201 | NP_388927.1 | hypothetical protein | - |
| BSU_10470 (BSU10470) | yhjD | 1121036..1121398 (-) | 363 | NP_388928.1 | hypothetical protein | - |
| BSU_10480 (BSU10480) | yhjE | 1121550..1122173 (+) | 624 | NP_388929.1 | putative integral membrane protein | - |
| BSU_10490 (BSU10490) | sipV | 1122175..1122681 (+) | 507 | NP_388930.1 | type I signal peptidase | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 192 a.a. Molecular weight: 22429.68 Da Isoelectric Point: 7.7153
MSQKTDAPLESYEVNGATIAVLPEEIDGKICSKIIEKDCVFYVNMKPLQIVDRSCRFFGSSYAGRKAGTYEVTKISHKPP
IMVDPSNQIFLFPTLSSTRPQCGWISHVHVKEFKATEFDDTEVTFSNGKTMELPISYNSFENQVYRTAWLRTKFQDRIDH
RVPKRQEFMLYPKEERTKMIYDFILRELGERY
Nucleotide
Download Length: 579 bp
ATGAGTCAGAAAACAGACGCACCTTTAGAATCGTATGAAGTGAACGGCGCAACAATTGCCGTGCTGCCAGAAGAAATAGA
CGGCAAAATCTGTTCCAAAATTATTGAAAAAGATTGCGTGTTTTATGTAAACATGAAGCCGCTGCAAATTGTCGACAGAA
GCTGCCGATTTTTTGGATCAAGCTATGCGGGAAGAAAAGCAGGAACTTATGAAGTGACAAAAATTTCACACAAGCCGCCG
ATCATGGTGGACCCTTCGAACCAAATCTTTTTATTCCCTACACTTTCTTCGACAAGACCCCAATGCGGCTGGATTTCCCA
TGTGCATGTAAAAGAATTCAAAGCGACTGAATTCGACGATACGGAAGTGACGTTTTCCAATGGGAAAACGATGGAGCTGC
CGATCTCTTATAATTCGTTCGAGAACCAGGTATACCGAACAGCGTGGCTCAGAACCAAATTCCAAGACAGAATCGACCAC
CGCGTGCCGAAAAGACAGGAATTTATGCTGTACCCGAAAGAAGAGCGGACGAAGATGATTTATGATTTTATTTTGCGTGA
GCTCGGGGAACGGTATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Eugenie J Dubnau et al. (2016) A protein complex supports the production of Spo0A-P and plays additional roles for biofilms and the K-state in Bacillus subtilis. Molecular Microbiology 101(4):606-24. [PMID: 27501195] |
| [2] | Mathieu Miras et al. (2016) A DegU-P and DegQ-Dependent Regulatory Pathway for the K-state in Bacillus subtilis. Frontiers in Microbiology 7:1868. [PMID: 27920766] |
| [3] | Regine Rahmer et al. (2015) Construction of a Super-Competent Bacillus subtilis 168 Using the P mtlA -comKS Inducible Cassette. Frontiers in Microbiology 6:1431. [PMID: 26732353] |
| [4] | Madeleine Leisner et al. (2007) Basal expression rate of comK sets a 'switching-window' into the K-state of Bacillus subtilis. Molecular Microbiology 63(6):1806-16. [PMID: 17367397] |
| [5] | Kim A Susanna et al. (2007) A single, specific thymine mutation in the ComK-binding site severely decreases binding and transcription activation by the competence transcription factor ComK of Bacillus subtilis. Journal of Bacteriology 189(13):4718-28. [PMID: 17468244] |
| [6] | Kim A Susanna et al. (2006) Functional analysis of the competence transcription factor ComK of Bacillus subtilis by characterization of truncation variants. Microbiology (Reading, England) 152(Pt 2):473-483. [PMID: 16436435] |
| [7] | Gürol M Süel et al. (2006) An excitable gene regulatory circuit induces transient cellular differentiation. Nature 440(7083):545-50. [PMID: 16554821] |
| [8] | J-W Veening et al. (2006) Single cell analysis of gene expression patterns of competence development and initiation of sporulation in Bacillus subtilis grown on chemically defined media. Journal of Applied Microbiology 101(3):531-41. [PMID: 16907804] |
| [9] | Mark Albano et al. (2005) The Rok protein of Bacillus subtilis represses genes for cell surface and extracellular functions. Journal of Bacteriology 187(6):2010-9. [PMID: 15743949] |
| [10] | Hédia Maamar et al. (2005) Bistability in the Bacillus subtilis K-state (competence) system requires a positive feedback loop. Molecular Microbiology 56(3):615-24. [PMID: 15819619] |
| [11] | K A Susanna et al. (2004) Mechanism of transcription activation at the comG promoter by the competence transcription factor ComK of Bacillus subtilis. Journal of Bacteriology 186(4):1120-8. [PMID: 14762007] |
| [12] | Leendert W Hamoen et al. (2003) The Bacillus subtilis transition state regulator AbrB binds to the -35 promoter region of comK. FEMS Microbiology Letters 218(2):299-304. [PMID: 12586407] |
| [13] | Randy M Berka et al. (2002) Microarray analysis of the Bacillus subtilis K-state: genome-wide expression changes dependent on ComK. Molecular Microbiology 43(5):1331-45. [PMID: 11918817] |
| [14] | Mitsuo Ogura et al. (2002) Whole-genome analysis of genes regulated by the Bacillus subtilis competence transcription factor ComK. Journal of Bacteriology 184(9):2344-51. [PMID: 11948146] |
| [15] | Leendert W Hamoen et al. (2002) Improving the predictive value of the competence transcription factor (ComK) binding site in Bacillus subtilis using a genomic approach. Nucleic Acids Research 30(24):5517-28. [PMID: 12490720] |
| [16] | J Liu et al. (1998) A molecular switch controlling competence and motility: competence regulatory factors ComS, MecA, and ComK control sigmaD-dependent gene expression in Bacillus subtilis. Journal of Bacteriology 180(16):4243-51. [PMID: 9696775] |
| [17] | K Turgay et al. (1998) Competence in Bacillus subtilis is controlled by regulated proteolysis of a transcription factor. The EMBO Journal 17(22):6730-8. [PMID: 9890793] |
| [18] | M Ogura et al. (1996) Bacillus subtilis DegU acts as a positive regulator for comK expression. FEBS Letters 397(2-3):173-6. [PMID: 8955341] |
| [19] | D van Sinderen et al. (1995) comK encodes the competence transcription factor, the key regulatory protein for competence development in Bacillus subtilis. Molecular Microbiology 15(3):455-62. [PMID: 7783616] |
| [20] | D van Sinderen et al. (1994) comK acts as an autoregulatory control switch in the signal transduction route to competence in Bacillus subtilis. Journal of Bacteriology 176(18):5762-70. [PMID: 8083168] |
| [21] | D van Sinderen et al. (1994) Molecular cloning and sequence of comK, a gene required for genetic competence in Bacillus subtilis. Molecular Microbiology 11(4):695-703. [PMID: 8196543] |