Detailed information NTG0000089

Experimentally validated

Overview

• Name: spo0A
• Type: Regulator
• Locus tag: BSU_24220
• Genome accession: NC_000964
• Coordinates: 2518023..2518826 (-)
• Length: 267 a.a.
• NCBI ID: NP_390302.1
• Uniprot ID: P06534
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: activation and repression of comK; repression of rok; repression of abrB Competence regulation

Function

In Bacillus subtilis, Spo0A plays a dual role in regulating the expression of comK. As the concentration of the response regulator Spo0A∼P increases during the entry to stationary phase it first induces comK promoter activity and then represses it by direct binding. Spo0A~P can release the comK expression by repressing AbrB. Spo0A∼P also activates comK expression by antagonizing the repressor Rok.

Genomic Context

Location: 2513023..2523826

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_24180 (BSU24180)	glpQ	2514169..2514900 (-)	732	NP_390298.2	glycerophosphodiester phosphodiesterase (exolytic cleavage of individual teichoic acid monomer units)	-
BSU_24190 (BSU24190)	yqiI	2514979..2515599 (-)	621	NP_390299.2	N-acetylmuramoyl-L-alanine amidase	-
BSU_24200 (BSU24200)	yqiH	2515614..2515907 (-)	294	NP_390300.2	putative lipoprotein	-
BSU_24205 (BSU24205)	-	2516215..2516367 (+)	153	YP_009513977.1	hypothetical protein	-
BSU_24210 (BSU24210)	yqiG	2516440..2517558 (+)	1119	NP_390301.1	putative NADH-dependent flavin oxidoreductase	-
BSU_24220 (BSU24220)	spo0A	2518023..2518826 (-)	804	NP_390302.1	response regulator, phosphorylated in response to complex YlbF/YmcA/YaaT	Regulator
BSU_24230 (BSU24230)	spoIVB	2519102..2520382 (-)	1281	NP_390303.2	regulatory membrane-associated serine protease	-
BSU_24240 (BSU24240)	recN	2520557..2522287 (-)	1731	NP_390304.2	factor for double strand breaks DNA repair and genetic recombination	Machinery gene
BSU_24250 (BSU24250)	argR	2522324..2522773 (-)	450	NP_390305.1	transcriptional regulator (AhrC(ArgR)-arginine)	-
BSU_24260 (BSU24260)	yqxC	2522871..2523716 (-)	846	NP_390306.2	putative 2'-O-ribose RNA methyltransferase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
spo0A	comK	negative effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
comS	comK	positive effect
spo0A	comK	positive effect
rok	comK	negative effect
degU	comK	positive effect
clpC	comK	negative effect
med	comK	positive effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
comA	comS	positive effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 267 a.a.
• Molecular weight: 29691.19 Da
• Isoelectric Point: 6.3913

>NTDB_id=89 BSU_24220 NP_390302.1 2518023..2518826(-) (spo0A) [Bacillus subtilis subsp. subtilis str. 168]
MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLFKEKDPDVLVLDIIMPHLDGLAVLERLRESDLKKQP
NVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLVGHIRQVSGNASSVTHRAPSSQSSIIRSSQPEPKKKNLDASITSI
IHEIGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTV
SMTKAKPTNSEFIAMVADKLRLEHKAS

Nucleotide

• Length: 804 bp

>NTDB_id=89 BSU_24220 NP_390302.1 2518023..2518826(-) (spo0A) [Bacillus subtilis subsp. subtilis str. 168]
GTGGAGAAAATTAAAGTTTGTGTTGCTGATGATAATCGAGAGCTGGTAAGCCTGTTAAGTGAATATATAGAAGGACAGGA
AGACATGGAAGTGATCGGCGTTGCTTATAACGGACAGGAATGCCTGTCGCTGTTTAAAGAAAAAGATCCCGATGTGCTCG
TATTAGATATTATTATGCCGCATCTAGACGGACTTGCGGTTTTAGAGAGGCTGAGGGAATCAGATCTGAAAAAACAGCCG
AATGTCATTATGCTGACAGCCTTTGGGCAGGAAGATGTCACGAAAAAGGCCGTCGATTTAGGCGCGTCCTACTTTATTCT
CAAACCGTTTGATATGGAAAACCTTGTCGGCCATATCCGCCAGGTCAGCGGAAATGCCAGCAGTGTGACGCATCGTGCGC
CATCATCGCAAAGCAGTATTATACGCAGCAGCCAGCCTGAACCAAAGAAGAAAAATCTCGACGCGAGCATCACAAGCATT
ATCCATGAAATCGGCGTCCCAGCCCATATTAAAGGCTATCTCTATCTGCGCGAAGCAATCTCAATGGTATACAATGACAT
CGAATTGCTCGGCAGCATTACAAAAGTCCTCTATCCGGACATCGCCAAAAAATTTAACACAACCGCAAGCCGTGTAGAAA
GAGCGATCCGCCATGCAATTGAAGTGGCATGGAGCAGAGGAAACATTGATTCCATTTCCTCGTTGTTTGGTTATACTGTC
AGCATGACAAAAGCTAAACCTACCAACAGTGAATTCATTGCAATGGTTGCGGATAAGCTGAGGTTAGAGCATAAGGCTTC
TTAA

Domains

Predicted by InterproScan.

• Sporulation initiation factor Spo0A C terminal (Spo0A_C) (157-260)

• Response regulator receiver domain (Response_reg) (6-119)

3D structure

• PDB: 1LQ1

References

• [1]: Eugenie J Dubnau et al. (2016) A protein complex supports the production of Spo0A-P and plays additional roles for biofilms and the K-state in Bacillus subtilis. Molecular Microbiology 101(4):606-24. [PMID: 27501195]
• [2]: Nicolas Mirouze et al. (2012) Spo0A~P imposes a temporal gate for the bimodal expression of competence in Bacillus subtilis. PLoS Genetics 8(3):e1002586. [PMID: 22412392]
• [3]: F Schmeisser et al. (2000) A new mutation in spo0A with intragenic suppressors in the effector domain. FEMS Microbiology Letters 185(2):123-8. [PMID: 10754235]
• [4]: I Mandic-Mulec et al. (1995) The Bacillus subtilis SinR protein is a repressor of the key sporulation gene spo0A. Journal of Bacteriology 177(16):4619-27. [PMID: 7642487]
• [5]: J Hahn et al. (1995) The major role of Spo0A in genetic competence is to downregulate abrB, an essential competence gene. Journal of Bacteriology 177(12):3601-5. [PMID: 7768874]