Detailed information    

experimental Experimentally validated

Overview


Name   spo0A   Type   Regulator
Locus tag   BSU_24220 Genome accession   NC_000964
Coordinates   2518023..2518826 (-) Length   267 a.a.
NCBI ID   NP_390302.1    Uniprot ID   P06534
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   activation and repression of comK; repression of rok; repression of abrB   
Competence regulation

Function


In Bacillus subtilis, Spo0A plays a dual role in regulating the expression of comK. As the concentration of the response regulator Spo0A∼P increases during the entry to stationary phase it first induces comK promoter activity and then represses it by direct binding. Spo0A~P can release the comK expression by repressing AbrB. Spo0A∼P also activates comK expression by antagonizing the repressor Rok.


Genomic Context


Location: 2513023..2523826
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_24180 (BSU24180) glpQ 2514169..2514900 (-) 732 NP_390298.2 glycerophosphodiester phosphodiesterase (exolytic cleavage of individual teichoic acid monomer units) -
  BSU_24190 (BSU24190) yqiI 2514979..2515599 (-) 621 NP_390299.2 N-acetylmuramoyl-L-alanine amidase -
  BSU_24200 (BSU24200) yqiH 2515614..2515907 (-) 294 NP_390300.2 putative lipoprotein -
  BSU_24205 (BSU24205) - 2516215..2516367 (+) 153 YP_009513977.1 hypothetical protein -
  BSU_24210 (BSU24210) yqiG 2516440..2517558 (+) 1119 NP_390301.1 putative NADH-dependent flavin oxidoreductase -
  BSU_24220 (BSU24220) spo0A 2518023..2518826 (-) 804 NP_390302.1 response regulator, phosphorylated in response to complex YlbF/YmcA/YaaT Regulator
  BSU_24230 (BSU24230) spoIVB 2519102..2520382 (-) 1281 NP_390303.2 regulatory membrane-associated serine protease -
  BSU_24240 (BSU24240) recN 2520557..2522287 (-) 1731 NP_390304.2 factor for double strand breaks DNA repair and genetic recombination Machinery gene
  BSU_24250 (BSU24250) argR 2522324..2522773 (-) 450 NP_390305.1 transcriptional regulator (AhrC(ArgR)-arginine) -
  BSU_24260 (BSU24260) yqxC 2522871..2523716 (-) 846 NP_390306.2 putative 2'-O-ribose RNA methyltransferase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  spo0A comK negative effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 267 a.a.        Molecular weight: 29691.19 Da        Isoelectric Point: 6.3913

>NTDB_id=89 BSU_24220 NP_390302.1 2518023..2518826(-) (spo0A) [Bacillus subtilis subsp. subtilis str. 168]
MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLFKEKDPDVLVLDIIMPHLDGLAVLERLRESDLKKQP
NVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLVGHIRQVSGNASSVTHRAPSSQSSIIRSSQPEPKKKNLDASITSI
IHEIGVPAHIKGYLYLREAISMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTV
SMTKAKPTNSEFIAMVADKLRLEHKAS

Nucleotide


Download         Length: 804 bp        

>NTDB_id=89 BSU_24220 NP_390302.1 2518023..2518826(-) (spo0A) [Bacillus subtilis subsp. subtilis str. 168]
GTGGAGAAAATTAAAGTTTGTGTTGCTGATGATAATCGAGAGCTGGTAAGCCTGTTAAGTGAATATATAGAAGGACAGGA
AGACATGGAAGTGATCGGCGTTGCTTATAACGGACAGGAATGCCTGTCGCTGTTTAAAGAAAAAGATCCCGATGTGCTCG
TATTAGATATTATTATGCCGCATCTAGACGGACTTGCGGTTTTAGAGAGGCTGAGGGAATCAGATCTGAAAAAACAGCCG
AATGTCATTATGCTGACAGCCTTTGGGCAGGAAGATGTCACGAAAAAGGCCGTCGATTTAGGCGCGTCCTACTTTATTCT
CAAACCGTTTGATATGGAAAACCTTGTCGGCCATATCCGCCAGGTCAGCGGAAATGCCAGCAGTGTGACGCATCGTGCGC
CATCATCGCAAAGCAGTATTATACGCAGCAGCCAGCCTGAACCAAAGAAGAAAAATCTCGACGCGAGCATCACAAGCATT
ATCCATGAAATCGGCGTCCCAGCCCATATTAAAGGCTATCTCTATCTGCGCGAAGCAATCTCAATGGTATACAATGACAT
CGAATTGCTCGGCAGCATTACAAAAGTCCTCTATCCGGACATCGCCAAAAAATTTAACACAACCGCAAGCCGTGTAGAAA
GAGCGATCCGCCATGCAATTGAAGTGGCATGGAGCAGAGGAAACATTGATTCCATTTCCTCGTTGTTTGGTTATACTGTC
AGCATGACAAAAGCTAAACCTACCAACAGTGAATTCATTGCAATGGTTGCGGATAAGCTGAGGTTAGAGCATAAGGCTTC
TTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 1LQ1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Eugenie J Dubnau et al. (2016) A protein complex supports the production of Spo0A-P and plays additional roles for biofilms and the K-state in Bacillus subtilis. Molecular Microbiology 101(4):606-24. [PMID: 27501195]
[2] Nicolas Mirouze et al. (2012) Spo0A~P imposes a temporal gate for the bimodal expression of competence in Bacillus subtilis. PLoS Genetics 8(3):e1002586. [PMID: 22412392]
[3] F Schmeisser et al. (2000) A new mutation in spo0A with intragenic suppressors in the effector domain. FEMS Microbiology Letters 185(2):123-8. [PMID: 10754235]
[4] I Mandic-Mulec et al. (1995) The Bacillus subtilis SinR protein is a repressor of the key sporulation gene spo0A. Journal of Bacteriology 177(16):4619-27. [PMID: 7642487]
[5] J Hahn et al. (1995) The major role of Spo0A in genetic competence is to downregulate abrB, an essential competence gene. Journal of Bacteriology 177(12):3601-5. [PMID: 7768874]