Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BSU_31720 | Genome accession | NC_000964 |
| Coordinates | 3257092..3257232 (-) | Length | 46 a.a. |
| NCBI ID | NP_391050.1 | Uniprot ID | Q99039 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | modification of regulators Competence regulation |
||
Genomic Context
Location: 3252092..3262232
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_31670 (BSU31670) | yuxO | 3252405..3252785 (-) | 381 | NP_391045.2 | putative proofreading thioesterase in bacillibactin biosynthesis | - |
| BSU_31680 (BSU31680) | comA | 3252804..3253448 (-) | 645 | NP_391046.1 | two-component response quorum-sensing regulator | Regulator |
| BSU_31690 (BSU31690) | comP | 3253529..3255838 (-) | 2310 | NP_391047.2 | two-component sensor histidine kinase | Regulator |
| BSU_31700 (BSU31700) | comX | 3255853..3256020 (-) | 168 | NP_391048.1 | competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified) | Regulator |
| BSU_31710 (BSU31710) | comQ | 3256008..3256907 (-) | 900 | NP_391049.2 | isoprenyl transferase (pre-ComX modification) | Regulator |
| BSU_31720 (BSU31720) | degQ | 3257092..3257232 (-) | 141 | NP_391050.1 | pleiotropic regulator | Regulator |
| BSU_31725 (BSU31725) | - | 3257454..3257579 (+) | 126 | YP_009514001.1 | hypothetical protein | - |
| BSU_31730 (BSU31730) | cotIC | 3257693..3258061 (+) | 369 | NP_391051.2 | inner spore coat protein | - |
| BSU_31740 (BSU31740) | pdeH | 3258037..3259266 (-) | 1230 | NP_391052.1 | cyclic di-GMP phosphodiesterase | - |
| BSU_31750 (BSU31750) | pncB | 3259403..3260875 (-) | 1473 | NP_391053.1 | nicotinate phosphoribosyltransferase | - |
| BSU_31760 (BSU31760) | pncA | 3260891..3261442 (-) | 552 | NP_391054.1 | nicotinamidase; NAD salvage pathway | - |
| BSU_31770 (BSU31770) | yueI | 3261539..3261937 (-) | 399 | NP_391055.1 | hypothetical protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| degQ | degU | positive effect |
| degU | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5546.44 Da Isoelectric Point: 6.2559
>NTDB_id=95 BSU_31720 NP_391050.1 3257092..3257232(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=95 BSU_31720 NP_391050.1 3257092..3257232(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Mathieu Miras et al. (2016) A DegU-P and DegQ-Dependent Regulatory Pathway for the K-state in Bacillus subtilis. Frontiers in Microbiology 7:1868. [PMID: 27920766] |
| [2] | T Msadek et al. (1991) DegS-DegU and ComP-ComA modulator-effector pairs control expression of the Bacillus subtilis pleiotropic regulatory gene degQ. Journal of Bacteriology 173(7):2366-77. [PMID: 1901055] |