Detailed information NTG0000095

Experimentally validated

Overview

• Name: degQ
• Type: Regulator
• Locus tag: BSU_31720
• Genome accession: NC_000964
• Coordinates: 3257092..3257232 (-)
• Length: 46 a.a.
• NCBI ID: NP_391050.1
• Uniprot ID: Q99039
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: modification of regulators Competence regulation

Function

The low level of DegQ decreases the concentration of phosphorylated DegU, which leads to the de-repression of the srfA operon and ultimately to the stabilization of ComK.

Genomic Context

Location: 3252092..3262232

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_31670 (BSU31670)	yuxO	3252405..3252785 (-)	381	NP_391045.2	putative proofreading thioesterase in bacillibactin biosynthesis	-
BSU_31680 (BSU31680)	comA	3252804..3253448 (-)	645	NP_391046.1	two-component response quorum-sensing regulator	Regulator
BSU_31690 (BSU31690)	comP	3253529..3255838 (-)	2310	NP_391047.2	two-component sensor histidine kinase	Regulator
BSU_31700 (BSU31700)	comX	3255853..3256020 (-)	168	NP_391048.1	competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified)	Regulator
BSU_31710 (BSU31710)	comQ	3256008..3256907 (-)	900	NP_391049.2	isoprenyl transferase (pre-ComX modification)	Regulator
BSU_31720 (BSU31720)	degQ	3257092..3257232 (-)	141	NP_391050.1	pleiotropic regulator	Regulator
BSU_31725 (BSU31725)	-	3257454..3257579 (+)	126	YP_009514001.1	hypothetical protein	-
BSU_31730 (BSU31730)	cotIC	3257693..3258061 (+)	369	NP_391051.2	inner spore coat protein	-
BSU_31740 (BSU31740)	pdeH	3258037..3259266 (-)	1230	NP_391052.1	cyclic di-GMP phosphodiesterase	-
BSU_31750 (BSU31750)	pncB	3259403..3260875 (-)	1473	NP_391053.1	nicotinate phosphoribosyltransferase	-
BSU_31760 (BSU31760)	pncA	3260891..3261442 (-)	552	NP_391054.1	nicotinamidase; NAD salvage pathway	-
BSU_31770 (BSU31770)	yueI	3261539..3261937 (-)	399	NP_391055.1	hypothetical protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
degQ	degU	positive effect
degU	comK	positive effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
comS	comK	positive effect
spo0A	comK	positive effect
rok	comK	negative effect
clpC	comK	negative effect
med	comK	positive effect
spo0A	comK	negative effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
comA	comS	positive effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 46 a.a.
• Molecular weight: 5546.44 Da
• Isoelectric Point: 6.2559

>NTDB_id=95 BSU_31720 NP_391050.1 3257092..3257232(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide

• Length: 141 bp

>NTDB_id=95 BSU_31720 NP_391050.1 3257092..3257232(-) (degQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

• DegQ (SacQ) family (DegQ) (1-46)

3D structure

• AlphaFold DB: Q99039

References

• [1]: Mathieu Miras et al. (2016) A DegU-P and DegQ-Dependent Regulatory Pathway for the K-state in Bacillus subtilis. Frontiers in Microbiology 7:1868. [PMID: 27920766]
• [2]: T Msadek et al. (1991) DegS-DegU and ComP-ComA modulator-effector pairs control expression of the Bacillus subtilis pleiotropic regulatory gene degQ. Journal of Bacteriology 173(7):2366-77. [PMID: 1901055]