Detailed information
Overview
| Name | mecA | Type | Regulator |
| Locus tag | BSU_11520 | Genome accession | NC_000964 |
| Coordinates | 1229068..1229724 (+) | Length | 218 a.a. |
| NCBI ID | NP_389034.1 | Uniprot ID | P37958 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | degradation of ComK Competence regulation |
||
Genomic Context
Location: 1224068..1234724
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_11470 (BSU11470) | oppF | 1224533..1225450 (+) | 918 | NP_389029.1 | oligopeptide ABC transporter (ATP-binding protein) | - |
| BSU_11480 (BSU11480) | yjbB | 1225557..1226774 (+) | 1218 | NP_389030.2 | putative exporter | - |
| BSU_11490 (BSU11490) | yjbC | 1226938..1227516 (+) | 579 | NP_389031.2 | putative thiol oxidation management factor; putative acetyltransferase | - |
| BSU_11500 (BSU11500) | spxA | 1227697..1228092 (+) | 396 | NP_389032.1 | redox-sensitive regulator | - |
| BSU_11510 (BSU11510) | yjbE | 1228135..1228791 (-) | 657 | NP_389033.1 | putative membrane protein of unknown function | - |
| BSU_11515 (BSU11515) | - | 1228961..1229101 (+) | 141 | YP_009513949.1 | hypothetical protein | - |
| BSU_11520 (BSU11520) | mecA | 1229068..1229724 (+) | 657 | NP_389034.1 | adaptor protein controlling oligomerization of the AAA+ protein ClpC | Regulator |
| BSU_11525 (BSU11525) | - | 1229719..1229841 (-) | 123 | YP_009513950.1 | hypothetical protein | - |
| BSU_11530 (BSU11530) | coiA | 1229915..1231036 (+) | 1122 | NP_389035.1 | protein involved in establishment of DNA transport in competence | Machinery gene |
| BSU_11540 (BSU11540) | pepF | 1231083..1233095 (+) | 2013 | NP_389036.2 | oligoendopeptidase F | Regulator |
| BSU_11549 (BSU11549) | yizD | 1233133..1233300 (-) | 168 | YP_003097703.1 | hypothetical protein | - |
| BSU_11550 (BSU11550) | spxH | 1233614..1234513 (-) | 900 | NP_389037.2 | thiol management effector of SpxA degradation | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| mecA | comK | negative effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 218 a.a. Molecular weight: 25763.69 Da Isoelectric Point: 4.1174
>NTDB_id=84 BSU_11520 NP_389034.1 1229068..1229724(+) (mecA) [Bacillus subtilis subsp. subtilis str. 168]
MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL
SKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVISLSKLNVNGSKTTLYSFENR
YYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS
MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL
SKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVISLSKLNVNGSKTTLYSFENR
YYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS
Nucleotide
Download Length: 657 bp
>NTDB_id=84 BSU_11520 NP_389034.1 1229068..1229724(+) (mecA) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAATTGAAAGAATTAACGAGCATACAGTAAAATTTTATATGTCTTACGGAGATATTGAAGATCGCGGTTTTGACAG
AGAAGAAATTTGGTATAACCGTGAGCGCAGTGAAGAACTTTTCTGGGAAGTCATGGATGAAGTTCATGAAGAAGAGGAAT
TCGCTGTGGAAGGCCCACTTTGGATTCAAGTTCAGGCACTGGACAAAGGATTAGAAATCATCGTCACAAAAGCCCAGCTT
TCCAAAGACGGACAAAAGCTCGAACTGCCGATTCCTGAGGATAAAAAGCAAGAACCAGCATCTGAGGATCTTGACGCCTT
GCTGGATGATTTCCAGAAAGAAGAGCAAGCCGTCAATCAGGAAGAGAAGGAGCAAAAGCTTCAATTTGTCTTGCGATTTG
GCGATTTTGAGGATGTTATTTCTCTATCTAAATTGAACGTTAACGGAAGCAAAACGACTTTATATTCGTTTGAGAACCGA
TATTATTTATATGTAGATTTTTGCAATATGACTGATGAAGAGGTTGAAAATCAGCTAAGCATCCTGCTGGAGTACGCAAC
TGAATCCTCAATCAGCATACACCGTCTTGAAGAGTACGGCAAGCTGATTATTTCAGAGCATGCTCTAGAAACGATAAAAA
AACACTTTGCATCATAG
ATGGAAATTGAAAGAATTAACGAGCATACAGTAAAATTTTATATGTCTTACGGAGATATTGAAGATCGCGGTTTTGACAG
AGAAGAAATTTGGTATAACCGTGAGCGCAGTGAAGAACTTTTCTGGGAAGTCATGGATGAAGTTCATGAAGAAGAGGAAT
TCGCTGTGGAAGGCCCACTTTGGATTCAAGTTCAGGCACTGGACAAAGGATTAGAAATCATCGTCACAAAAGCCCAGCTT
TCCAAAGACGGACAAAAGCTCGAACTGCCGATTCCTGAGGATAAAAAGCAAGAACCAGCATCTGAGGATCTTGACGCCTT
GCTGGATGATTTCCAGAAAGAAGAGCAAGCCGTCAATCAGGAAGAGAAGGAGCAAAAGCTTCAATTTGTCTTGCGATTTG
GCGATTTTGAGGATGTTATTTCTCTATCTAAATTGAACGTTAACGGAAGCAAAACGACTTTATATTCGTTTGAGAACCGA
TATTATTTATATGTAGATTTTTGCAATATGACTGATGAAGAGGTTGAAAATCAGCTAAGCATCCTGCTGGAGTACGCAAC
TGAATCCTCAATCAGCATACACCGTCTTGAAGAGTACGGCAAGCTGATTATTTCAGAGCATGCTCTAGAAACGATAAAAA
AACACTTTGCATCATAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Andrew W Tanner et al. (2018) ClpC and MecA, components of a proteolytic machine, prevent Spo0A-P-dependent transcription without degradation. Molecular Microbiology 108(2):178-186. [PMID: 29446505] |
| [2] | Jing Liu et al. (2013) Structural dynamics of the MecA-ClpC complex: a type II AAA+ protein unfolding machine. The Journal of Biological Chemistry 288(24):17597-608. [PMID: 23595989] |
| [3] | Ziqing Mei et al. (2009) Molecular determinants of MecA as a degradation tag for the ClpCP protease. The Journal of Biological Chemistry 284(49):34366-75. [PMID: 19767395] |
| [4] | Feng Wang et al. (2009) Crystal structure of the MecA degradation tag. The Journal of Biological Chemistry 284(49):34376-81. [PMID: 19801546] |
| [5] | Tilman Schlothauer et al. (2003) MecA, an adaptor protein necessary for ClpC chaperone activity. Proceedings of The National Academy of Sciences of The United States of America 100(5):2306-11. [PMID: 12598648] |
| [6] | Michiko M Nakano et al. (2002) Spx (YjbD), a negative effector of competence in Bacillus subtilis, enhances ClpC-MecA-ComK interaction. Molecular Microbiology 44(5):1341-9. [PMID: 12028382] |
| [7] | M Ogura et al. (1999) Mutational analysis of ComS: evidence for the interaction of ComS and MecA in the regulation of competence development in Bacillus subtilis. Molecular Microbiology 32(4):799-812. [PMID: 10361283] |
| [8] | M Persuh et al. (1999) The N- and C-terminal domains of MecA recognize different partners in the competence molecular switch. Molecular Microbiology 33(4):886-94. [PMID: 10447896] |
| [9] | K Turgay et al. (1997) Biochemical characterization of a molecular switch involving the heat shock protein ClpC, which controls the activity of ComK, the competence transcription factor of Bacillus subtilis. Genes & Development 11(1):119-28. [PMID: 9000055] |
| [10] | J Hahn et al. (1995) Inactivation of mecA prevents recovery from the competent state and interferes with cell division and the partitioning of nucleoids in Bacillus subtilis. Molecular Microbiology 18(4):755-67. [PMID: 8817496] |
| [11] | L Kong et al. (1994) Regulation of competence-specific gene expression by Mec-mediated protein-protein interaction in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 91(13):5793-7. [PMID: 8016067] |
| [12] | L Kong et al. (1993) Sequence and properties of mecA, a negative regulator of genetic competence in Bacillus subtilis. Molecular Microbiology 9(2):365-73. [PMID: 8412687] |