Detailed information    

experimental Experimentally validated

Overview


Name   mecA   Type   Regulator
Locus tag   BSU_11520 Genome accession   NC_000964
Coordinates   1229068..1229724 (+) Length   218 a.a.
NCBI ID   NP_389034.1    Uniprot ID   P37958
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   degradation of ComK   
Competence regulation

Function


ComK is targeted by the adaptor protein MecA and degraded in a complex with ClpC and ClpP. ComS counteracts MecA by preventing ComK degradation via the ClpC/ClpP complex, thereby stabilizing ComK and promoting competence.


Genomic Context


Location: 1224068..1234724
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_11470 (BSU11470) oppF 1224533..1225450 (+) 918 NP_389029.1 oligopeptide ABC transporter (ATP-binding protein) -
  BSU_11480 (BSU11480) yjbB 1225557..1226774 (+) 1218 NP_389030.2 putative exporter -
  BSU_11490 (BSU11490) yjbC 1226938..1227516 (+) 579 NP_389031.2 putative thiol oxidation management factor; putative acetyltransferase -
  BSU_11500 (BSU11500) spxA 1227697..1228092 (+) 396 NP_389032.1 redox-sensitive regulator -
  BSU_11510 (BSU11510) yjbE 1228135..1228791 (-) 657 NP_389033.1 putative membrane protein of unknown function -
  BSU_11515 (BSU11515) - 1228961..1229101 (+) 141 YP_009513949.1 hypothetical protein -
  BSU_11520 (BSU11520) mecA 1229068..1229724 (+) 657 NP_389034.1 adaptor protein controlling oligomerization of the AAA+ protein ClpC Regulator
  BSU_11525 (BSU11525) - 1229719..1229841 (-) 123 YP_009513950.1 hypothetical protein -
  BSU_11530 (BSU11530) coiA 1229915..1231036 (+) 1122 NP_389035.1 protein involved in establishment of DNA transport in competence Machinery gene
  BSU_11540 (BSU11540) pepF 1231083..1233095 (+) 2013 NP_389036.2 oligoendopeptidase F Regulator
  BSU_11549 (BSU11549) yizD 1233133..1233300 (-) 168 YP_003097703.1 hypothetical protein -
  BSU_11550 (BSU11550) spxH 1233614..1234513 (-) 900 NP_389037.2 thiol management effector of SpxA degradation -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  mecA comK negative effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 218 a.a.        Molecular weight: 25763.69 Da        Isoelectric Point: 4.1174

>NTDB_id=84 BSU_11520 NP_389034.1 1229068..1229724(+) (mecA) [Bacillus subtilis subsp. subtilis str. 168]
MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKGLEIIVTKAQL
SKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVISLSKLNVNGSKTTLYSFENR
YYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS

Nucleotide


Download         Length: 657 bp        

>NTDB_id=84 BSU_11520 NP_389034.1 1229068..1229724(+) (mecA) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAATTGAAAGAATTAACGAGCATACAGTAAAATTTTATATGTCTTACGGAGATATTGAAGATCGCGGTTTTGACAG
AGAAGAAATTTGGTATAACCGTGAGCGCAGTGAAGAACTTTTCTGGGAAGTCATGGATGAAGTTCATGAAGAAGAGGAAT
TCGCTGTGGAAGGCCCACTTTGGATTCAAGTTCAGGCACTGGACAAAGGATTAGAAATCATCGTCACAAAAGCCCAGCTT
TCCAAAGACGGACAAAAGCTCGAACTGCCGATTCCTGAGGATAAAAAGCAAGAACCAGCATCTGAGGATCTTGACGCCTT
GCTGGATGATTTCCAGAAAGAAGAGCAAGCCGTCAATCAGGAAGAGAAGGAGCAAAAGCTTCAATTTGTCTTGCGATTTG
GCGATTTTGAGGATGTTATTTCTCTATCTAAATTGAACGTTAACGGAAGCAAAACGACTTTATATTCGTTTGAGAACCGA
TATTATTTATATGTAGATTTTTGCAATATGACTGATGAAGAGGTTGAAAATCAGCTAAGCATCCTGCTGGAGTACGCAAC
TGAATCCTCAATCAGCATACACCGTCTTGAAGAGTACGGCAAGCTGATTATTTCAGAGCATGCTCTAGAAACGATAAAAA
AACACTTTGCATCATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 2Y1R
  PDB 3J3R
  PDB 3J3S
  PDB 3J3T
  PDB 3J3U
  PDB 3JTP
  PDB 3PXG
  PDB 3PXI

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Andrew W Tanner et al. (2018) ClpC and MecA, components of a proteolytic machine, prevent Spo0A-P-dependent transcription without degradation. Molecular Microbiology 108(2):178-186. [PMID: 29446505]
[2] Jing Liu et al. (2013) Structural dynamics of the MecA-ClpC complex: a type II AAA+ protein unfolding machine. The Journal of Biological Chemistry 288(24):17597-608. [PMID: 23595989]
[3] Ziqing Mei et al. (2009) Molecular determinants of MecA as a degradation tag for the ClpCP protease. The Journal of Biological Chemistry 284(49):34366-75. [PMID: 19767395]
[4] Feng Wang et al. (2009) Crystal structure of the MecA degradation tag. The Journal of Biological Chemistry 284(49):34376-81. [PMID: 19801546]
[5] Tilman Schlothauer et al. (2003) MecA, an adaptor protein necessary for ClpC chaperone activity. Proceedings of The National Academy of Sciences of The United States of America 100(5):2306-11. [PMID: 12598648]
[6] Michiko M Nakano et al. (2002) Spx (YjbD), a negative effector of competence in Bacillus subtilis, enhances ClpC-MecA-ComK interaction. Molecular Microbiology 44(5):1341-9. [PMID: 12028382]
[7] M Ogura et al. (1999) Mutational analysis of ComS: evidence for the interaction of ComS and MecA in the regulation of competence development in Bacillus subtilis. Molecular Microbiology 32(4):799-812. [PMID: 10361283]
[8] M Persuh et al. (1999) The N- and C-terminal domains of MecA recognize different partners in the competence molecular switch. Molecular Microbiology 33(4):886-94. [PMID: 10447896]
[9] K Turgay et al. (1997) Biochemical characterization of a molecular switch involving the heat shock protein ClpC, which controls the activity of ComK, the competence transcription factor of Bacillus subtilis. Genes & Development 11(1):119-28. [PMID: 9000055]
[10] J Hahn et al. (1995) Inactivation of mecA prevents recovery from the competent state and interferes with cell division and the partitioning of nucleoids in Bacillus subtilis. Molecular Microbiology 18(4):755-67. [PMID: 8817496]
[11] L Kong et al. (1994) Regulation of competence-specific gene expression by Mec-mediated protein-protein interaction in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 91(13):5793-7. [PMID: 8016067]
[12] L Kong et al. (1993) Sequence and properties of mecA, a negative regulator of genetic competence in Bacillus subtilis. Molecular Microbiology 9(2):365-73. [PMID: 8412687]