Detailed information    

experimental Experimentally validated

Overview


Name   phrF   Type   Regulator
Locus tag   BSU_37470 Genome accession   NC_000964
Coordinates   3847130..3847249 (+) Length   39 a.a.
NCBI ID   NP_391627.1    Uniprot ID   P71001
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   antagonize RapF   
Competence regulation

Function


PhrF peptide antagonizes RapF, preventing it from inhibiting ComA.


Genomic Context


Location: 3842130..3852249
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_37430 (BSU37430) albG 3842294..3842995 (+) 702 NP_391623.1 putative integral membrane protein involved in subtilosin production and immunity -
  BSU_37440 (BSU37440) ywhL 3843001..3844377 (-) 1377 NP_391624.1 hypothetical protein -
  BSU_37450 (BSU37450) ywhK 3844416..3845771 (-) 1356 NP_391625.1 factor interacting with DNA helicase PcrA -
  BSU_37460 (BSU37460) rapF 3846001..3847146 (+) 1146 NP_391626.1 response regulator aspartate phosphatase anti-activator of ComA Regulator
  BSU_37470 (BSU37470) phrF 3847130..3847249 (+) 120 NP_391627.1 secreted regulator of the activity of phosphatase RapF Regulator
  BSU_37480 (BSU37480) ywhH 3847348..3847821 (+) 474 NP_391628.1 putative tRNA editing enzyme -
  BSU_37490 (BSU37490) speB 3847853..3848725 (-) 873 NP_391629.1 agmatinase -
  BSU_37500 (BSU37500) speE 3848786..3849616 (-) 831 NP_391630.1 spermidine synthase; polyamine metabolism -
  BSU_37510 (BSU37510) pbpG 3849818..3851893 (+) 2076 NP_391631.2 sporulation specific penicillin-binding protein 2D -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  phrF rapF negative effect
  rapF comA negative effect
  comA comS positive effect
  comS comK positive effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4199.10 Da        Isoelectric Point: 10.4997

>NTDB_id=129 BSU_37470 NP_391627.1 3847130..3847249(+) (phrF) [Bacillus subtilis subsp. subtilis str. 168]
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI

Nucleotide


Download         Length: 120 bp        

>NTDB_id=129 BSU_37470 NP_391627.1 3847130..3847249(+) (phrF) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P71001

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

48.718

100

0.487


Multiple sequence alignment    



References


[1] Cristina Bongiorni et al. (2005) Synergistic regulation of competence development in Bacillus subtilis by two Rap-Phr systems. Journal of Bacteriology 187(13):4353-61. [PMID: 15968044]