Detailed information
Overview
| Name | phrF | Type | Regulator |
| Locus tag | BSU_37470 | Genome accession | NC_000964 |
| Coordinates | 3847130..3847249 (+) | Length | 39 a.a. |
| NCBI ID | NP_391627.1 | Uniprot ID | P71001 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | antagonize RapF Competence regulation |
||
Genomic Context
Location: 3842130..3852249
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_37430 (BSU37430) | albG | 3842294..3842995 (+) | 702 | NP_391623.1 | putative integral membrane protein involved in subtilosin production and immunity | - |
| BSU_37440 (BSU37440) | ywhL | 3843001..3844377 (-) | 1377 | NP_391624.1 | hypothetical protein | - |
| BSU_37450 (BSU37450) | ywhK | 3844416..3845771 (-) | 1356 | NP_391625.1 | factor interacting with DNA helicase PcrA | - |
| BSU_37460 (BSU37460) | rapF | 3846001..3847146 (+) | 1146 | NP_391626.1 | response regulator aspartate phosphatase anti-activator of ComA | Regulator |
| BSU_37470 (BSU37470) | phrF | 3847130..3847249 (+) | 120 | NP_391627.1 | secreted regulator of the activity of phosphatase RapF | Regulator |
| BSU_37480 (BSU37480) | ywhH | 3847348..3847821 (+) | 474 | NP_391628.1 | putative tRNA editing enzyme | - |
| BSU_37490 (BSU37490) | speB | 3847853..3848725 (-) | 873 | NP_391629.1 | agmatinase | - |
| BSU_37500 (BSU37500) | speE | 3848786..3849616 (-) | 831 | NP_391630.1 | spermidine synthase; polyamine metabolism | - |
| BSU_37510 (BSU37510) | pbpG | 3849818..3851893 (+) | 2076 | NP_391631.2 | sporulation specific penicillin-binding protein 2D | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| phrF | rapF | negative effect |
| rapF | comA | negative effect |
| comA | comS | positive effect |
| comS | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 39 a.a. Molecular weight: 4199.10 Da Isoelectric Point: 10.4997
>NTDB_id=129 BSU_37470 NP_391627.1 3847130..3847249(+) (phrF) [Bacillus subtilis subsp. subtilis str. 168]
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI
Nucleotide
Download Length: 120 bp
>NTDB_id=129 BSU_37470 NP_391627.1 3847130..3847249(+) (phrF) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| phrC | Bacillus subtilis subsp. subtilis str. 168 |
48.718 |
100 |
0.487 |
Multiple sequence alignment
References
| [1] | Cristina Bongiorni et al. (2005) Synergistic regulation of competence development in Bacillus subtilis by two Rap-Phr systems. Journal of Bacteriology 187(13):4353-61. [PMID: 15968044] |