Detailed information
Overview
| Name | comX | Type | Regulator |
| Locus tag | BSU_31700 | Genome accession | NC_000964 |
| Coordinates | 3255853..3256020 (-) | Length | 55 a.a. |
| NCBI ID | NP_391048.1 | Uniprot ID | P45453 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | binding to ComP; trigger autophosphorylation of ComP Competence regulation |
||
Function
ComX is a signaling peptide that, once modified by the isoprenyl transferase ComQ, binds to the membrane-bound histidine kinase ComP. This interaction leads to the autophosphorylation of ComP and subsequent phosphorylation of ComA, a response regulator that activates the transcription of the srfA operon. The srfA operon includes genes required for surfactin production and competence development, such as comS, which ultimately promote the expression of comK, the master regulator of competence.
Genomic Context
Location: 3250853..3261020
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_31640 (BSU31640) | mrpE | 3251248..3251724 (+) | 477 | YP_054591.2 | non essential component of Na+/H+ antiporter | - |
| BSU_31650 (BSU31650) | mrpF | 3251724..3252008 (+) | 285 | NP_391043.2 | efflux transporter for Na+ and cholate | - |
| BSU_31660 (BSU31660) | mrpG | 3251992..3252366 (+) | 375 | NP_391044.1 | non essential component of Na+/H+ antiporter | - |
| BSU_31670 (BSU31670) | yuxO | 3252405..3252785 (-) | 381 | NP_391045.2 | putative proofreading thioesterase in bacillibactin biosynthesis | - |
| BSU_31680 (BSU31680) | comA | 3252804..3253448 (-) | 645 | NP_391046.1 | two-component response quorum-sensing regulator | Regulator |
| BSU_31690 (BSU31690) | comP | 3253529..3255838 (-) | 2310 | NP_391047.2 | two-component sensor histidine kinase | Regulator |
| BSU_31700 (BSU31700) | comX | 3255853..3256020 (-) | 168 | NP_391048.1 | competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified) | Regulator |
| BSU_31710 (BSU31710) | comQ | 3256008..3256907 (-) | 900 | NP_391049.2 | isoprenyl transferase (pre-ComX modification) | Regulator |
| BSU_31720 (BSU31720) | degQ | 3257092..3257232 (-) | 141 | NP_391050.1 | pleiotropic regulator | Regulator |
| BSU_31725 (BSU31725) | - | 3257454..3257579 (+) | 126 | YP_009514001.1 | hypothetical protein | - |
| BSU_31730 (BSU31730) | cotIC | 3257693..3258061 (+) | 369 | NP_391051.2 | inner spore coat protein | - |
| BSU_31740 (BSU31740) | pdeH | 3258037..3259266 (-) | 1230 | NP_391052.1 | cyclic di-GMP phosphodiesterase | - |
| BSU_31750 (BSU31750) | pncB | 3259403..3260875 (-) | 1473 | NP_391053.1 | nicotinate phosphoribosyltransferase | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comX | comP | positive effect |
| comP | comA | positive effect |
| comA | comS | positive effect |
| comS | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 55 a.a. Molecular weight: 6518.42 Da Isoelectric Point: 4.3285
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD
Nucleotide
Download Length: 168 bp
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Chantal Treinen et al. (2021) Modeling the time course of ComX: towards molecular process control for Bacillus wild-type cultivations. AMB Express 11(1):144. [PMID: 34714452] |
| [2] | Mihael Špacapan et al. (2020) The ComX Quorum Sensing Peptide of Bacillus subtilis Affects Biofilm Formation Negatively and Sporulation Positively. Microorganisms 8(8):1131. [PMID: 32727033] |
| [3] | Masahiro Okada et al. (2008) Chemical structure of posttranslational modification with a farnesyl group on tryptophan. Bioscience, Biotechnology, And Biochemistry 72(3):914-8. [PMID: 18323630] |
| [4] | Masahiro Okada et al. (2007) Structure-activity relationship studies on quorum sensing ComX(RO-E-2) pheromone. Bioorganic & Medicinal Chemistry Letters 17(6):1705-7. [PMID: 17240141] |
| [5] | Natalia Comella et al. (2005) Conservation of genes and processes controlled by the quorum response in bacteria: characterization of genes controlled by the quorum-sensing transcription factor ComA in Bacillus subtilis. Molecular Microbiology 57(4):1159-74. [PMID: 16091051] |
| [6] | Masahiro Okada et al. (2005) Structure of the Bacillus subtilis quorum-sensing peptide pheromone ComX. Nature Chemical Biology 1(1):23-4. [PMID: 16407988] |
| [7] | M Ansaldi et al. (2004) Diversifying selection at the Bacillus quorum-sensing locus and determinants of modification specificity during synthesis of the ComX pheromone. Journal of Bacteriology 186(1):15-21. [PMID: 14679219] |
| [8] | Katherine Bacon Schneider et al. (2002) Characterization of comQ and comX, two genes required for production of ComX pheromone in Bacillus subtilis. Journal of Bacteriology 184(2):410-9. [PMID: 11751817] |
| [9] | Mireille Ansaldi et al. (2002) Specific activation of the Bacillus quorum-sensing systems by isoprenylated pheromone variants. Molecular Microbiology 44(6):1561-73. [PMID: 12067344] |
| [10] | R Magnuson et al. (1994) Biochemical and genetic characterization of a competence pheromone from B. subtilis. Cell 77(2):207-16. [PMID: 8168130] |