Detailed information NTG0000092

Experimentally validated

Overview

• Name: comX
• Type: Regulator
• Locus tag: BSU_31700
• Genome accession: NC_000964
• Coordinates: 3255853..3256020 (-)
• Length: 55 a.a.
• NCBI ID: NP_391048.1
• Uniprot ID: -
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: binding to ComP; trigger autophosphorylation of ComP Competence regulation

Function

ComX is a signaling peptide that, once modified by the isoprenyl transferase ComQ, binds to the membrane-bound histidine kinase ComP. This interaction leads to the autophosphorylation of ComP and subsequent phosphorylation of ComA, a response regulator that activates the transcription of the srfA operon. The srfA operon includes genes required for surfactin production and competence development, such as comS, which ultimately promote the expression of comK, the master regulator of competence.

Genomic Context

Location: 3250853..3261020

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_31640 (BSU31640)	mrpE	3251248..3251724 (+)	477	YP_054591.2	non essential component of Na+/H+ antiporter	-
BSU_31650 (BSU31650)	mrpF	3251724..3252008 (+)	285	NP_391043.2	efflux transporter for Na+ and cholate	-
BSU_31660 (BSU31660)	mrpG	3251992..3252366 (+)	375	NP_391044.1	non essential component of Na+/H+ antiporter	-
BSU_31670 (BSU31670)	yuxO	3252405..3252785 (-)	381	NP_391045.2	putative proofreading thioesterase in bacillibactin biosynthesis	-
BSU_31680 (BSU31680)	comA	3252804..3253448 (-)	645	NP_391046.1	two-component response quorum-sensing regulator	Regulator
BSU_31690 (BSU31690)	comP	3253529..3255838 (-)	2310	NP_391047.2	two-component sensor histidine kinase	Regulator
BSU_31700 (BSU31700)	comX	3255853..3256020 (-)	168	NP_391048.1	competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified)	Regulator
BSU_31710 (BSU31710)	comQ	3256008..3256907 (-)	900	NP_391049.2	isoprenyl transferase (pre-ComX modification)	Regulator
BSU_31720 (BSU31720)	degQ	3257092..3257232 (-)	141	NP_391050.1	pleiotropic regulator	Regulator
BSU_31725 (BSU31725)	-	3257454..3257579 (+)	126	YP_009514001.1	hypothetical protein	-
BSU_31730 (BSU31730)	cotIC	3257693..3258061 (+)	369	NP_391051.2	inner spore coat protein	-
BSU_31740 (BSU31740)	pdeH	3258037..3259266 (-)	1230	NP_391052.1	cyclic di-GMP phosphodiesterase	-
BSU_31750 (BSU31750)	pncB	3259403..3260875 (-)	1473	NP_391053.1	nicotinate phosphoribosyltransferase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comX	comP	positive effect
comP	comA	positive effect
comA	comS	positive effect
comS	comK	positive effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
spo0A	comK	positive effect
rok	comK	negative effect
degU	comK	positive effect
clpC	comK	negative effect
med	comK	positive effect
spo0A	comK	negative effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comQ	comX	positive effect

Sequence

Protein

• Length: 55 a.a.
• Molecular weight: 6518.42 Da
• Isoelectric Point: 4.3285

>NTDB_id=92 BSU_31700 NP_391048.1 3255853..3256020(-) (comX) [Bacillus subtilis subsp. subtilis str. 168]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide

• Length: 168 bp

>NTDB_id=92 BSU_31700 NP_391048.1 3255853..3256020(-) (comX) [Bacillus subtilis subsp. subtilis str. 168]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains

No domain identified.

References

• [1]: Chantal Treinen et al. (2021) Modeling the time course of ComX: towards molecular process control for Bacillus wild-type cultivations. AMB Express 11(1):144. [PMID: 34714452]
• [2]: Mihael Špacapan et al. (2020) The ComX Quorum Sensing Peptide of Bacillus subtilis Affects Biofilm Formation Negatively and Sporulation Positively. Microorganisms 8(8):1131. [PMID: 32727033]
• [3]: Masahiro Okada et al. (2008) Chemical structure of posttranslational modification with a farnesyl group on tryptophan. Bioscience, Biotechnology, And Biochemistry 72(3):914-8. [PMID: 18323630]
• [4]: Masahiro Okada et al. (2007) Structure-activity relationship studies on quorum sensing ComX(RO-E-2) pheromone. Bioorganic & Medicinal Chemistry Letters 17(6):1705-7. [PMID: 17240141]
• [5]: Natalia Comella et al. (2005) Conservation of genes and processes controlled by the quorum response in bacteria: characterization of genes controlled by the quorum-sensing transcription factor ComA in Bacillus subtilis. Molecular Microbiology 57(4):1159-74. [PMID: 16091051]
• [6]: Masahiro Okada et al. (2005) Structure of the Bacillus subtilis quorum-sensing peptide pheromone ComX. Nature Chemical Biology 1(1):23-4. [PMID: 16407988]
• [7]: M Ansaldi et al. (2004) Diversifying selection at the Bacillus quorum-sensing locus and determinants of modification specificity during synthesis of the ComX pheromone. Journal of Bacteriology 186(1):15-21. [PMID: 14679219]
• [8]: Katherine Bacon Schneider et al. (2002) Characterization of comQ and comX, two genes required for production of ComX pheromone in Bacillus subtilis. Journal of Bacteriology 184(2):410-9. [PMID: 11751817]
• [9]: Mireille Ansaldi et al. (2002) Specific activation of the Bacillus quorum-sensing systems by isoprenylated pheromone variants. Molecular Microbiology 44(6):1561-73. [PMID: 12067344]
• [10]: R Magnuson et al. (1994) Biochemical and genetic characterization of a competence pheromone from B. subtilis. Cell 77(2):207-16. [PMID: 8168130]