Detailed information NTG0000087

Experimentally validated

Overview

• Name: comS
• Type: Regulator
• Locus tag: BSU_03500
• Genome accession: NC_000964
• Coordinates: 390880..391020 (+)
• Length: 46 a.a.
• NCBI ID: NP_388232.1
• Uniprot ID: P80355
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: preventing the degradation of ComK Competence regulation

Function

ComS is part of the srfA operon and acts as an anti-adaptor protein. It competes with ComK for binding to the MecA, thereby displacing ComK and preventing its degradation by the ClpC/ClpP protease. This competition prevents the degradation of ComK, thereby stabilizing its levels and promoting the establishment of competence.

Genomic Context

Location: 385880..396020

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_03500 (BSU03500)	comS	390880..391020 (+)	141	NP_388232.1	regulator of genetic competence	Regulator

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comS	comK	positive effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
spo0A	comK	positive effect
rok	comK	negative effect
degU	comK	positive effect
clpC	comK	negative effect
med	comK	positive effect
spo0A	comK	negative effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
comA	comS	positive effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 46 a.a.
• Molecular weight: 5244.05 Da
• Isoelectric Point: 9.2422

>NTDB_id=87 BSU_03500 NP_388232.1 390880..391020(+) (comS) [Bacillus subtilis subsp. subtilis str. 168]
MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWREK

Nucleotide

• Length: 141 bp

>NTDB_id=87 BSU_03500 NP_388232.1 390880..391020(+) (comS) [Bacillus subtilis subsp. subtilis str. 168]
TTGAACCGATCAGGCAAGCATCTTATCAGCAGCATTATCCTGTATCCCCGGCCCAGCGGAGAATGTATATCCTCAATCAG
CTTGGACAAGCAAACACAAGCTACAACGTCCCCGCTGTACTTCTGCTGGAGGGAGAAGTAG

Domains

Predicted by InterproScan.

• Bacillus competence protein S (ComS) (1-44)

3D structure

• AlphaFold DB: P80355

References

• [1]: Regine Rahmer et al. (2015) Construction of a Super-Competent Bacillus subtilis 168 Using the P mtlA -comKS Inducible Cassette. Frontiers in Microbiology 6:1431. [PMID: 26732353]
• [2]: Gürol M Süel et al. (2006) An excitable gene regulatory circuit induces transient cellular differentiation. Nature 440(7083):545-50. [PMID: 16554821]
• [3]: M Ogura et al. (1999) Mutational analysis of ComS: evidence for the interaction of ComS and MecA in the regulation of competence development in Bacillus subtilis. Molecular Microbiology 32(4):799-812. [PMID: 10361283]
• [4]: J Liu et al. (1998) A molecular switch controlling competence and motility: competence regulatory factors ComS, MecA, and ComK control sigmaD-dependent gene expression in Bacillus subtilis. Journal of Bacteriology 180(16):4243-51. [PMID: 9696775]
• [5]: K Turgay et al. (1998) Competence in Bacillus subtilis is controlled by regulated proteolysis of a transcription factor. The EMBO Journal 17(22):6730-8. [PMID: 9890793]
• [6]: L Liu et al. (1996) Plasmid-amplified comS enhances genetic competence and suppresses sinR in Bacillus subtilis. Journal of Bacteriology 178(17):5144-52. [PMID: 8752331]
• [7]: C D'Souza et al. (1995) Translation of the open reading frame encoded by comS, a gene of the srf operon, is necessary for the development of genetic competence, but not surfactin biosynthesis, in Bacillus subtilis. Journal of Bacteriology 177(14):4144-8. [PMID: 7608091]
• [8]: L W Hamoen et al. (1995) A small gene, designated comS, located within the coding region of the fourth amino acid-activation domain of srfA, is required for competence development in Bacillus subtilis. Molecular Microbiology 15(1):55-63. [PMID: 7752896]
• [9]: C D'Souza et al. (1994) Identification of comS, a gene of the srfA operon that regulates the establishment of genetic competence in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 91(20):9397-401. [PMID: 7937777]