Detailed information NTG0000088

Experimentally validated

Overview

• Name: kre
• Type: Regulator
• Locus tag: BSU_14020
• Genome accession: NC_000964
• Coordinates: 1474560..1475024 (-)
• Length: 154 a.a.
• NCBI ID: NP_389285.1
• Uniprot ID: -
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: regulation of regulators Competence regulation

Function

Kre appears to modulate the induction of ComK by affecting the stability of comK mRNA.

Genomic Context

Location: 1469560..1480024

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_13990 (BSU13990)	kinA	1470026..1471846 (+)	1821	NP_389282.1	sporulation-specific ATP-dependent protein histidine kinase	-
BSU_14000 (BSU14000)	dapX	1471857..1473038 (-)	1182	NP_389283.2	N-acetyl-L,L-diaminopimelate aminotransferase	-
BSU_14009 (BSU14009)	ykzT	1473240..1473401 (-)	162	YP_003097722.1	hypothetical protein	-
BSU_14010 (BSU14010)	cheV	1473605..1474516 (+)	912	NP_389284.1	coupling protein and response regulator for CheA activity in response to attractants (chemotaxis)	-
BSU_14020 (BSU14020)	kre	1474560..1475024 (-)	465	NP_389285.1	regulator of transcription factor ComK function via modulation of mRNA stability	Regulator
BSU_14030 (BSU14030)	ykuC	1475150..1476442 (-)	1293	NP_389286.2	putative transporter	-
BSU_14040 (BSU14040)	ltdD	1476518..1477012 (-)	495	NP_389287.1	murein L,D-transpeptidase	-
BSU_14050 (BSU14050)	ppeE	1477069..1477929 (-)	861	NP_389288.2	exported metallophosphoesterase (Mn2+ and Zn2+)	-
BSU_14060 (BSU14060)	fadH	1478072..1478836 (+)	765	NP_389289.1	putative 2,4-dienoyl-CoA reductase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
kre	comK	negative effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
abrB	comK	negative effect
comS	comK	positive effect
spo0A	comK	positive effect
rok	comK	negative effect
degU	comK	positive effect
clpC	comK	negative effect
med	comK	positive effect
spo0A	comK	negative effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
comA	comS	positive effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 154 a.a.
• Molecular weight: 17895.71 Da
• Isoelectric Point: 10.3545

>NTDB_id=88 BSU_14020 NP_389285.1 1474560..1475024(-) (kre) [Bacillus subtilis subsp. subtilis str. 168]
MDDHAYTKDLQPTVENLSKAVYTVNRHAKTAPNPKYLYLLKKRALQKLVKEGKGKKIGLHFSKNPRFSQQQSDVLISIGD
YYFHMPPTKEDFEHLPHLGTLNQSYRNPKAQMSLTKAKHLLQEYVGMKEKPLVPNRQQPAYHKPVFKKLGESYF

Nucleotide

• Length: 465 bp

>NTDB_id=88 BSU_14020 NP_389285.1 1474560..1475024(-) (kre) [Bacillus subtilis subsp. subtilis str. 168]
ATGGACGACCATGCATATACGAAAGATCTGCAGCCAACCGTAGAAAATCTTTCAAAAGCAGTTTACACTGTGAACCGCCA
TGCAAAAACCGCCCCCAACCCTAAATACCTATATCTGCTGAAAAAACGGGCTTTGCAAAAGCTTGTCAAAGAAGGTAAAG
GAAAGAAAATAGGGCTTCATTTTTCAAAAAATCCAAGGTTCAGCCAACAGCAATCGGACGTGCTTATCTCAATCGGAGAC
TACTATTTTCACATGCCTCCAACTAAAGAAGACTTCGAACATCTTCCGCATTTAGGTACACTTAATCAATCGTATCGAAA
TCCTAAAGCTCAAATGTCTTTAACAAAAGCGAAACACCTATTGCAAGAATATGTCGGCATGAAAGAAAAGCCGCTAGTGC
CAAATCGCCAGCAGCCAGCTTACCATAAACCGGTCTTTAAAAAACTTGGCGAGAGTTACTTTTAA

Domains

Predicted by InterproScan.

• YkyB-like protein (YkyB) (14-128)

References

• [1]: Pamela Gamba et al. (2015) A Novel Feedback Loop That Controls Bimodal Expression of Genetic Competence. PLoS Genetics 11(6):e1005047. [PMID: 26110430]