Detailed information    

experimental Experimentally validated

Overview


Name   kre   Type   Regulator
Locus tag   BSU_14020 Genome accession   NC_000964
Coordinates   1474560..1475024 (-) Length   154 a.a.
NCBI ID   NP_389285.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   regulation of regulators   
Competence regulation

Function


Kre appears to modulate the induction of ComK by affecting the stability of comK mRNA.


Genomic Context


Location: 1469560..1480024
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_13990 (BSU13990) kinA 1470026..1471846 (+) 1821 NP_389282.1 sporulation-specific ATP-dependent protein histidine kinase -
  BSU_14000 (BSU14000) dapX 1471857..1473038 (-) 1182 NP_389283.2 N-acetyl-L,L-diaminopimelate aminotransferase -
  BSU_14009 (BSU14009) ykzT 1473240..1473401 (-) 162 YP_003097722.1 hypothetical protein -
  BSU_14010 (BSU14010) cheV 1473605..1474516 (+) 912 NP_389284.1 coupling protein and response regulator for CheA activity in response to attractants (chemotaxis) -
  BSU_14020 (BSU14020) kre 1474560..1475024 (-) 465 NP_389285.1 regulator of transcription factor ComK function via modulation of mRNA stability Regulator
  BSU_14030 (BSU14030) ykuC 1475150..1476442 (-) 1293 NP_389286.2 putative transporter -
  BSU_14040 (BSU14040) ltdD 1476518..1477012 (-) 495 NP_389287.1 murein L,D-transpeptidase -
  BSU_14050 (BSU14050) ppeE 1477069..1477929 (-) 861 NP_389288.2 exported metallophosphoesterase (Mn2+ and Zn2+) -
  BSU_14060 (BSU14060) fadH 1478072..1478836 (+) 765 NP_389289.1 putative 2,4-dienoyl-CoA reductase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  kre comK negative effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 17895.71 Da        Isoelectric Point: 10.3545

>NTDB_id=88 BSU_14020 NP_389285.1 1474560..1475024(-) (kre) [Bacillus subtilis subsp. subtilis str. 168]
MDDHAYTKDLQPTVENLSKAVYTVNRHAKTAPNPKYLYLLKKRALQKLVKEGKGKKIGLHFSKNPRFSQQQSDVLISIGD
YYFHMPPTKEDFEHLPHLGTLNQSYRNPKAQMSLTKAKHLLQEYVGMKEKPLVPNRQQPAYHKPVFKKLGESYF

Nucleotide


Download         Length: 465 bp        

>NTDB_id=88 BSU_14020 NP_389285.1 1474560..1475024(-) (kre) [Bacillus subtilis subsp. subtilis str. 168]
ATGGACGACCATGCATATACGAAAGATCTGCAGCCAACCGTAGAAAATCTTTCAAAAGCAGTTTACACTGTGAACCGCCA
TGCAAAAACCGCCCCCAACCCTAAATACCTATATCTGCTGAAAAAACGGGCTTTGCAAAAGCTTGTCAAAGAAGGTAAAG
GAAAGAAAATAGGGCTTCATTTTTCAAAAAATCCAAGGTTCAGCCAACAGCAATCGGACGTGCTTATCTCAATCGGAGAC
TACTATTTTCACATGCCTCCAACTAAAGAAGACTTCGAACATCTTCCGCATTTAGGTACACTTAATCAATCGTATCGAAA
TCCTAAAGCTCAAATGTCTTTAACAAAAGCGAAACACCTATTGCAAGAATATGTCGGCATGAAAGAAAAGCCGCTAGTGC
CAAATCGCCAGCAGCCAGCTTACCATAAACCGGTCTTTAAAAAACTTGGCGAGAGTTACTTTTAA

Domains


Predicted by InterProScan.

(14-128)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Pamela Gamba et al. (2015) A Novel Feedback Loop That Controls Bimodal Expression of Genetic Competence. PLoS Genetics 11(6):e1005047. [PMID: 26110430]