Detailed information    

experimental Experimentally validated

Overview


Name   sinI   Type   Regulator
Locus tag   BSU_24600 Genome accession   NC_000964
Coordinates   2552446..2552619 (+) Length   57 a.a.
NCBI ID   NP_390340.1    Uniprot ID   P23308
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   inhibit the expression of sinR   
Competence regulation

Function


In Bacillus subtilis, the sinI gene encodes a protein that acts as an antagonist to SinR, a master regulator of biofilm formation and competence development. SinI functions by forming heterodimers with SinR, thereby inhibiting SinR's ability to bind and bend DNA, which is essential for repressing biofilm and competence-related genes. This antagonistic interaction allows for the derepression of genes involved in competence, facilitating the transition to a competent state where cells can take up exogenous DNA.


Genomic Context


Location: 2547446..2557619
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_24570 (BSU24570) gcvT 2548245..2549333 (-) 1089 NP_390337.2 aminomethyltransferase (glycine cleavage system protein T) -
  BSU_24580 (BSU24580) yqhH 2549775..2551448 (+) 1674 NP_390338.1 putative RNA polymerase-associated helicase protein -
  BSU_24590 (BSU24590) yqhG 2551469..2552263 (+) 795 NP_390339.1 hypothetical protein -
  BSU_24600 (BSU24600) sinI 2552446..2552619 (+) 174 NP_390340.1 antagonist of SinR Regulator
  BSU_24610 (BSU24610) sinR 2552653..2552988 (+) 336 NP_390341.1 master regulator of biofilm formation Regulator
  BSU_24620 (BSU24620) tasA 2553081..2553866 (-) 786 NP_390342.1 major biofilm matrix component -
  BSU_24630 (BSU24630) sipW 2553930..2554502 (-) 573 NP_390343.1 type I signal peptidase -
  BSU_24640 (BSU24640) tapA 2554486..2555247 (-) 762 NP_390344.1 lipoprotein for biofilm formation -
  BSU_24650 (BSU24650) yqzG 2555519..2555845 (+) 327 NP_390345.1 hypothetical protein -
  BSU_24660 (BSU24660) spoIIT 2555887..2556066 (-) 180 NP_390346.2 factor involved in sporulation -
  BSU_24670 (BSU24670) comGG 2556137..2556511 (-) 375 NP_390347.1 component of the DNA transport pilin platform Machinery gene
  BSU_24680 (BSU24680) comGF 2556512..2556895 (-) 384 NP_390348.1 component of the DNA transport pilin platform Machinery gene
  BSU_24690 (BSU24690) comGE 2556921..2557268 (-) 348 NP_390349.1 component of the DNA transport pilin platform Machinery gene

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sinI sinR negative effect
  sinR degU negative effect
  degU comK positive effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=104 BSU_24600 NP_390340.1 2552446..2552619(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=104 BSU_24600 NP_390340.1 2552446..2552619(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 1B0N
  PDB 5TMX

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Usha Kantiwal et al. (2023) Efficient Inhibition of Bacterial Biofilm Through Interference of Protein-Protein Interaction of Master Regulator Proteins: a Proof of Concept Study with SinR- SinI Complex of Bacillus subtilis. Applied Biochemistry And Biotechnology 195(3):1947-1967. [PMID: 36401726]
[2] Morgan E Milton et al. (2020) The Solution Structures and Interaction of SinR and SinI: Elucidating the Mechanism of Action of the Master Regulator Switch for Biofilm Formation in Bacillus subtilis. Journal of Molecular Biology 432(2):343-357. [PMID: 31493408]
[3] D J Scott et al. (1999) Quaternary re-arrangement analysed by spectral enhancement: the interaction of a sporulation repressor with its antagonist. Journal of Molecular Biology 293(5):997-1004. [PMID: 10547280]
[4] R J Lewis et al. (1996) Crystallisation of the Bacillus subtilis sporulation inhibitor SinR, complexed with its antagonist, SinI. FEBS Letters 378(1):98-100. [PMID: 8549812]
[5] U Bai et al. (1993) SinI modulates the activity of SinR, a developmental switch protein of Bacillus subtilis, by protein-protein interaction. Genes & Development 7(1):139-48. [PMID: 8422983]