Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSU_24600 | Genome accession | NC_000964 |
| Coordinates | 2552446..2552619 (+) | Length | 57 a.a. |
| NCBI ID | NP_390340.1 | Uniprot ID | P23308 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | inhibit the expression of sinR Competence regulation |
||
Function
In Bacillus subtilis, the sinI gene encodes a protein that acts as an antagonist to SinR, a master regulator of biofilm formation and competence development. SinI functions by forming heterodimers with SinR, thereby inhibiting SinR's ability to bind and bend DNA, which is essential for repressing biofilm and competence-related genes. This antagonistic interaction allows for the derepression of genes involved in competence, facilitating the transition to a competent state where cells can take up exogenous DNA.
Genomic Context
Location: 2547446..2557619
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_24570 (BSU24570) | gcvT | 2548245..2549333 (-) | 1089 | NP_390337.2 | aminomethyltransferase (glycine cleavage system protein T) | - |
| BSU_24580 (BSU24580) | yqhH | 2549775..2551448 (+) | 1674 | NP_390338.1 | putative RNA polymerase-associated helicase protein | - |
| BSU_24590 (BSU24590) | yqhG | 2551469..2552263 (+) | 795 | NP_390339.1 | hypothetical protein | - |
| BSU_24600 (BSU24600) | sinI | 2552446..2552619 (+) | 174 | NP_390340.1 | antagonist of SinR | Regulator |
| BSU_24610 (BSU24610) | sinR | 2552653..2552988 (+) | 336 | NP_390341.1 | master regulator of biofilm formation | Regulator |
| BSU_24620 (BSU24620) | tasA | 2553081..2553866 (-) | 786 | NP_390342.1 | major biofilm matrix component | - |
| BSU_24630 (BSU24630) | sipW | 2553930..2554502 (-) | 573 | NP_390343.1 | type I signal peptidase | - |
| BSU_24640 (BSU24640) | tapA | 2554486..2555247 (-) | 762 | NP_390344.1 | lipoprotein for biofilm formation | - |
| BSU_24650 (BSU24650) | yqzG | 2555519..2555845 (+) | 327 | NP_390345.1 | hypothetical protein | - |
| BSU_24660 (BSU24660) | spoIIT | 2555887..2556066 (-) | 180 | NP_390346.2 | factor involved in sporulation | - |
| BSU_24670 (BSU24670) | comGG | 2556137..2556511 (-) | 375 | NP_390347.1 | component of the DNA transport pilin platform | Machinery gene |
| BSU_24680 (BSU24680) | comGF | 2556512..2556895 (-) | 384 | NP_390348.1 | component of the DNA transport pilin platform | Machinery gene |
| BSU_24690 (BSU24690) | comGE | 2556921..2557268 (-) | 348 | NP_390349.1 | component of the DNA transport pilin platform | Machinery gene |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| sinI | sinR | negative effect |
| sinR | degU | negative effect |
| degU | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Usha Kantiwal et al. (2023) Efficient Inhibition of Bacterial Biofilm Through Interference of Protein-Protein Interaction of Master Regulator Proteins: a Proof of Concept Study with SinR- SinI Complex of Bacillus subtilis. Applied Biochemistry And Biotechnology 195(3):1947-1967. [PMID: 36401726] |
| [2] | Morgan E Milton et al. (2020) The Solution Structures and Interaction of SinR and SinI: Elucidating the Mechanism of Action of the Master Regulator Switch for Biofilm Formation in Bacillus subtilis. Journal of Molecular Biology 432(2):343-357. [PMID: 31493408] |
| [3] | D J Scott et al. (1999) Quaternary re-arrangement analysed by spectral enhancement: the interaction of a sporulation repressor with its antagonist. Journal of Molecular Biology 293(5):997-1004. [PMID: 10547280] |
| [4] | R J Lewis et al. (1996) Crystallisation of the Bacillus subtilis sporulation inhibitor SinR, complexed with its antagonist, SinI. FEBS Letters 378(1):98-100. [PMID: 8549812] |
| [5] | U Bai et al. (1993) SinI modulates the activity of SinR, a developmental switch protein of Bacillus subtilis, by protein-protein interaction. Genes & Development 7(1):139-48. [PMID: 8422983] |