Detailed information    

experimental Experimentally validated

Overview


Name   abrB   Type   Regulator
Locus tag   BSU_00370 Genome accession   NC_000964
Coordinates   44848..45138 (-) Length   96 a.a.
NCBI ID   NP_387918.1    Uniprot ID   P08874
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   repression of comK; repression of rok   
Competence regulation

Function


In the natural transformation process of Bacillus subtilis, the abrB gene encodes a global regulatory protein that plays a significant role in controlling the transition from exponential growth to stationary phase and in regulating various cellular processes, including competence development. AbrB acts as a repressor of several key regulatory pathways in B. subtilis, including the competence pathway. The expression of comK, the master regulator of competence, is negatively regulated by AbrB. When spo0A (a key regulator of sporulation) is active, it represses abrB expression, thereby indirectly promoting competence by relieving the repression on comK. This regulatory cascade highlights AbrB's role in balancing competence development and sporulation in response to environmental signals. SinR and AbrB act negatively on rok transcription.


Genomic Context


Location: 39848..50138
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_00290 (BSU00290) darA 39871..40200 (+) 330 NP_387910.1 signal transduction receptor, cyclic di-AMP binding -
  BSU_00300 (BSU00300) yaaR 40213..40653 (+) 441 NP_387911.1 hypothetical protein -
  BSU_00310 (BSU00310) holB 40665..41654 (+) 990 NP_387912.1 DNA polymerase III clamp loader delta' subunit -
  BSU_00320 (BSU00320) yaaT 41657..42484 (+) 828 NP_387913.1 subunit of a sporulation, competence and biofilm formation regulatory complex of RNaseY (RicAFT complex / FAD / two [4Fe-4S]2+) Regulator
  BSU_00330 (BSU00330) dnaH 42499..42858 (+) 360 NP_387914.1 subunit of the DNA replication complex -
  BSU_00340 (BSU00340) trmNF 42917..43660 (+) 744 NP_387915.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  BSU_00350 (BSU00350) yazA 43647..43946 (+) 300 NP_387916.1 putative UvrC-Intron-type (URI) endonuclease -
  BSU_00360 (BSU00360) rsmI 43921..44799 (+) 879 NP_387917.1 16S rRNA 2'-O-ribose C1402 methyltransferase -
  BSU_00370 (BSU00370) abrB 44848..45138 (-) 291 NP_387918.1 transcriptional regulator for transition state genes (AbrB-SurF) Regulator
  BSU_00380 (BSU00380) metS 45633..47627 (+) 1995 NP_387919.1 methionyl-tRNA synthetase -
  BSU_00390 (BSU00390) dayD 47706..48473 (+) 768 NP_387920.1 D-amino acyl-tRNA deacylase -
  BSU_00400 (BSU00400) yabE 48629..49942 (+) 1314 NP_387921.1 putative cell wall shaping enzyme -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  abrB comK negative effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 96 a.a.        Molecular weight: 10772.62 Da        Isoelectric Point: 6.3482

>NTDB_id=80 BSU_00370 NP_387918.1 44848..45138(-) (abrB) [Bacillus subtilis subsp. subtilis str. 168]
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK

Nucleotide


Download         Length: 291 bp        

>NTDB_id=80 BSU_00370 NP_387918.1 44848..45138(-) (abrB) [Bacillus subtilis subsp. subtilis str. 168]
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTTATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATCTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGATGATAACCTTAAACTTGCAGGCGGTAAATTGGTTCTTAGTAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 1YFB
  PDB 1YSF
  PDB 1Z0R
  PDB 2K1N
  PDB 2MJG
  PDB 2RO4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Leendert W Hamoen et al. (2003) The Bacillus subtilis transition state regulator AbrB binds to the -35 promoter region of comK. FEMS Microbiology Letters 218(2):299-304. [PMID: 12586407]
[2] Tran Thu Hoa et al. (2002) Rok (YkuW) regulates genetic competence in Bacillus subtilis by directly repressing comK. Molecular Microbiology 43(1):15-26. [PMID: 11849533]
[3] Qiang Qian et al. (2002) AbrB is a regulator of the sigma(W) regulon in Bacillus subtilis. FEMS Microbiology Letters 211(2):219-23. [PMID: 12076816]
[4] F Schmeisser et al. (2000) A new mutation in spo0A with intragenic suppressors in the effector domain. FEMS Microbiology Letters 185(2):123-8. [PMID: 10754235]