Detailed information
Overview
| Name | abrB | Type | Regulator |
| Locus tag | BSU_00370 | Genome accession | NC_000964 |
| Coordinates | 44848..45138 (-) | Length | 96 a.a. |
| NCBI ID | NP_387918.1 | Uniprot ID | P08874 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | repression of comK; repression of rok Competence regulation |
||
Function
In the natural transformation process of Bacillus subtilis, the abrB gene encodes a global regulatory protein that plays a significant role in controlling the transition from exponential growth to stationary phase and in regulating various cellular processes, including competence development.
AbrB acts as a repressor of several key regulatory pathways in B. subtilis, including the competence pathway. The expression of comK, the master regulator of competence, is negatively regulated by AbrB. When spo0A (a key regulator of sporulation) is active, it represses abrB expression, thereby indirectly promoting competence by relieving the repression on comK. This regulatory cascade highlights AbrB's role in balancing competence development and sporulation in response to environmental signals. SinR and AbrB act negatively on rok transcription.
Genomic Context
Location: 39848..50138
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_00290 (BSU00290) | darA | 39871..40200 (+) | 330 | NP_387910.1 | signal transduction receptor, cyclic di-AMP binding | - |
| BSU_00300 (BSU00300) | yaaR | 40213..40653 (+) | 441 | NP_387911.1 | hypothetical protein | - |
| BSU_00310 (BSU00310) | holB | 40665..41654 (+) | 990 | NP_387912.1 | DNA polymerase III clamp loader delta' subunit | - |
| BSU_00320 (BSU00320) | yaaT | 41657..42484 (+) | 828 | NP_387913.1 | subunit of a sporulation, competence and biofilm formation regulatory complex of RNaseY (RicAFT complex / FAD / two [4Fe-4S]2+) | Regulator |
| BSU_00330 (BSU00330) | dnaH | 42499..42858 (+) | 360 | NP_387914.1 | subunit of the DNA replication complex | - |
| BSU_00340 (BSU00340) | trmNF | 42917..43660 (+) | 744 | NP_387915.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| BSU_00350 (BSU00350) | yazA | 43647..43946 (+) | 300 | NP_387916.1 | putative UvrC-Intron-type (URI) endonuclease | - |
| BSU_00360 (BSU00360) | rsmI | 43921..44799 (+) | 879 | NP_387917.1 | 16S rRNA 2'-O-ribose C1402 methyltransferase | - |
| BSU_00370 (BSU00370) | abrB | 44848..45138 (-) | 291 | NP_387918.1 | transcriptional regulator for transition state genes (AbrB-SurF) | Regulator |
| BSU_00380 (BSU00380) | metS | 45633..47627 (+) | 1995 | NP_387919.1 | methionyl-tRNA synthetase | - |
| BSU_00390 (BSU00390) | dayD | 47706..48473 (+) | 768 | NP_387920.1 | D-amino acyl-tRNA deacylase | - |
| BSU_00400 (BSU00400) | yabE | 48629..49942 (+) | 1314 | NP_387921.1 | putative cell wall shaping enzyme | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| abrB | comK | negative effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| degU | comK | positive effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10772.62 Da Isoelectric Point: 6.3482
MFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLAGGKLVLSKEG
AEQIISEIQNQLQNLK
Nucleotide
Download Length: 291 bp
ATGTTTATGAAATCTACTGGTATTGTACGTAAAGTTGATGAATTAGGACGTGTAGTTATTCCTATCGAACTGCGTCGTAC
TCTTGGAATCGCAGAAAAAGATGCTCTTGAAATCTATGTTGATGATGAAAAAATCATCCTTAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACTGGTGAAGTTTCTGATGATAACCTTAAACTTGCAGGCGGTAAATTGGTTCTTAGTAAAGAAGGC
GCTGAGCAAATCATCAGCGAAATCCAAAACCAGCTTCAAAACCTTAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Leendert W Hamoen et al. (2003) The Bacillus subtilis transition state regulator AbrB binds to the -35 promoter region of comK. FEMS Microbiology Letters 218(2):299-304. [PMID: 12586407] |
| [2] | Tran Thu Hoa et al. (2002) Rok (YkuW) regulates genetic competence in Bacillus subtilis by directly repressing comK. Molecular Microbiology 43(1):15-26. [PMID: 11849533] |
| [3] | Qiang Qian et al. (2002) AbrB is a regulator of the sigma(W) regulon in Bacillus subtilis. FEMS Microbiology Letters 211(2):219-23. [PMID: 12076816] |
| [4] | F Schmeisser et al. (2000) A new mutation in spo0A with intragenic suppressors in the effector domain. FEMS Microbiology Letters 185(2):123-8. [PMID: 10754235] |