Detailed information    

experimental Experimentally validated

Overview


Name   degU   Type   Regulator
Locus tag   BSU_35490 Genome accession   NC_000964
Coordinates   3644607..3645296 (-) Length   229 a.a.
NCBI ID   NP_391429.1    Uniprot ID   P13800
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   activation of comK   
Competence regulation

Function


The degU gene is part of the DegS-DegU two-component system. In its low phosphorylation state, DegU activates the expression of comK, the master regulator of competence. DegU binds specifically to the comK promoter, and strongly stimulates the binding of ComK to the comK promoter. Additionally, DegU regulates other processes such as biofilm formation, motility, and sporulation, highlighting its pleiotropic nature.


Genomic Context


Location: 3639607..3650296
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_35420 (BSU35420) flgN 3639787..3640269 (-) 483 NP_391422.1 factor required for flagellar based motility -
  BSU_35430 (BSU35430) flgM 3640285..3640551 (-) 267 NP_391423.1 anti-sigma factor repressor of sigma(D)-dependent transcription -
  BSU_35440 (BSU35440) yvyF 3640632..3641051 (-) 420 NP_391424.1 putative transcriptional regulator of flagella formation -
  BSU_35450 (BSU35450) comFC 3641125..3641847 (-) 723 NP_391425.2 component of the DNA transport apparatus Machinery gene
  BSU_35460 (BSU35460) comFB 3641811..3642107 (-) 297 NP_391426.1 regulator of competence, pole located -
  BSU_35470 (BSU35470) comFA 3642167..3643558 (-) 1392 NP_391427.1 ATP-dependent helicase competence protein Machinery gene
  BSU_35480 (BSU35480) fakBA 3643664..3644509 (-) 846 NP_391428.1 fatty acid kinase fatty acid binding subunit A -
  BSU_35490 (BSU35490) degU 3644607..3645296 (-) 690 NP_391429.1 two-component response regulator Regulator
  BSU_35500 (BSU35500) degS 3645379..3646536 (-) 1158 NP_391430.1 two-component sensor histidine kinase [DegU] Regulator
  BSU_35510 (BSU35510) yvyE 3646753..3647406 (+) 654 NP_391431.1 putative translation regulator -
  BSU_35520 (BSU35520) tagV 3647406..3648581 (+) 1176 NP_391432.1 teichoic acid-peptidoglycan tethering enzyme (LCP component) with transcription regulator domain -
  BSU_35530 (BSU35530) tagO 3648654..3649730 (-) 1077 NP_391433.1 UDP-N-acetylglucosamine:undecaprenyl-P N-acetylglucosaminyl-1-P transferase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  degU comK positive effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence


Protein


Download         Length: 229 a.a.        Molecular weight: 25866.57 Da        Isoelectric Point: 5.9446

>NTDB_id=83 BSU_35490 NP_391429.1 3644607..3645296(-) (degU) [Bacillus subtilis subsp. subtilis str. 168]
MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGDEAARIVEHYHPDVVIMDINMPNVNGVEATKQLVELYPESKV
IILSIHDDENYVTHALKTGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYPEIR
RPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWVEMR

Nucleotide


Download         Length: 690 bp        

>NTDB_id=83 BSU_35490 NP_391429.1 3644607..3645296(-) (degU) [Bacillus subtilis subsp. subtilis str. 168]
GTGACTAAAGTAAACATTGTTATTATCGACGACCATCAGTTATTTCGTGAAGGTGTTAAACGGATATTGGATTTTGAACC
TACCTTTGAAGTGGTAGCCGAAGGTGATGACGGGGACGAAGCGGCTCGTATTGTTGAGCACTATCATCCTGATGTTGTGA
TCATGGATATCAATATGCCAAACGTAAATGGTGTGGAAGCTACAAAACAGCTTGTAGAGCTGTATCCTGAATCTAAAGTA
ATTATTCTATCAATTCACGATGACGAAAATTATGTAACACATGCCCTGAAAACAGGTGCAAGAGGTTATCTGCTGAAAGA
GATGGATGCTGATACATTAATTGAAGCGGTTAAAGTAGTGGCTGAGGGCGGATCTTACCTCCATCCGAAGGTTACTCACA
ACCTCGTTAACGAATTCCGCCGCCTTGCAACAAGCGGAGTTTCTGCACACCCTCAACATGAGGTTTACCCTGAAATCCGC
AGACCATTACATATTTTAACTAGGCGGGAATGTGAAGTGCTGCAGATGCTTGCAGACGGAAAAAGCAACCGCGGTATTGG
TGAATCATTGTTTATCAGTGAGAAAACCGTTAAAAACCATGTCAGCAATATTTTACAAAAAATGAATGTAAACGACCGGA
CGCAAGCCGTTGTGGTCGCCATTAAAAATGGCTGGGTAGAAATGAGATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P13800

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraR Staphylococcus aureus N315

34.821

100

0.373


Multiple sequence alignment    



References


[1] Kana Shimane et al. (2004) Mutational analysis of the helix-turn-helix region of Bacillus subtilis response regulator DegU, and identification of cis-acting sequences for DegU in the aprE and comK promoters. Journal of Biochemistry 136(3):387-97. [PMID: 15598897]
[2] L W Hamoen et al. (2000) The pleiotropic response regulator DegU functions as a priming protein in competence development in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 97(16):9246-51. [PMID: 10908654]
[3] M Ogura et al. (1996) Bacillus subtilis DegU acts as a positive regulator for comK expression. FEBS Letters 397(2-3):173-6. [PMID: 8955341]
[4] F Kunst et al. (1994) The DegS/DegU and ComP/ComA two-component systems are part of a network controlling degradative enzyme synthesis and competence in Bacillus subtilis. Research in Microbiology 145(5-6):393-402. [PMID: 7855425]