Detailed information
Overview
| Name | degU | Type | Regulator |
| Locus tag | BSU_35490 | Genome accession | NC_000964 |
| Coordinates | 3644607..3645296 (-) | Length | 229 a.a. |
| NCBI ID | NP_391429.1 | Uniprot ID | P13800 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | activation of comK Competence regulation |
||
Function
The degU gene is part of the DegS-DegU two-component system. In its low phosphorylation state, DegU activates the expression of comK, the master regulator of competence. DegU binds specifically to the comK promoter, and strongly stimulates the binding of ComK to the comK promoter. Additionally, DegU regulates other processes such as biofilm formation, motility, and sporulation, highlighting its pleiotropic nature.
Genomic Context
Location: 3639607..3650296
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_35420 (BSU35420) | flgN | 3639787..3640269 (-) | 483 | NP_391422.1 | factor required for flagellar based motility | - |
| BSU_35430 (BSU35430) | flgM | 3640285..3640551 (-) | 267 | NP_391423.1 | anti-sigma factor repressor of sigma(D)-dependent transcription | - |
| BSU_35440 (BSU35440) | yvyF | 3640632..3641051 (-) | 420 | NP_391424.1 | putative transcriptional regulator of flagella formation | - |
| BSU_35450 (BSU35450) | comFC | 3641125..3641847 (-) | 723 | NP_391425.2 | component of the DNA transport apparatus | Machinery gene |
| BSU_35460 (BSU35460) | comFB | 3641811..3642107 (-) | 297 | NP_391426.1 | regulator of competence, pole located | - |
| BSU_35470 (BSU35470) | comFA | 3642167..3643558 (-) | 1392 | NP_391427.1 | ATP-dependent helicase competence protein | Machinery gene |
| BSU_35480 (BSU35480) | fakBA | 3643664..3644509 (-) | 846 | NP_391428.1 | fatty acid kinase fatty acid binding subunit A | - |
| BSU_35490 (BSU35490) | degU | 3644607..3645296 (-) | 690 | NP_391429.1 | two-component response regulator | Regulator |
| BSU_35500 (BSU35500) | degS | 3645379..3646536 (-) | 1158 | NP_391430.1 | two-component sensor histidine kinase [DegU] | Regulator |
| BSU_35510 (BSU35510) | yvyE | 3646753..3647406 (+) | 654 | NP_391431.1 | putative translation regulator | - |
| BSU_35520 (BSU35520) | tagV | 3647406..3648581 (+) | 1176 | NP_391432.1 | teichoic acid-peptidoglycan tethering enzyme (LCP component) with transcription regulator domain | - |
| BSU_35530 (BSU35530) | tagO | 3648654..3649730 (-) | 1077 | NP_391433.1 | UDP-N-acetylglucosamine:undecaprenyl-P N-acetylglucosaminyl-1-P transferase | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| degU | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| sinR | degU | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 229 a.a. Molecular weight: 25866.57 Da Isoelectric Point: 5.9446
MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGDEAARIVEHYHPDVVIMDINMPNVNGVEATKQLVELYPESKV
IILSIHDDENYVTHALKTGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYPEIR
RPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWVEMR
Nucleotide
Download Length: 690 bp
GTGACTAAAGTAAACATTGTTATTATCGACGACCATCAGTTATTTCGTGAAGGTGTTAAACGGATATTGGATTTTGAACC
TACCTTTGAAGTGGTAGCCGAAGGTGATGACGGGGACGAAGCGGCTCGTATTGTTGAGCACTATCATCCTGATGTTGTGA
TCATGGATATCAATATGCCAAACGTAAATGGTGTGGAAGCTACAAAACAGCTTGTAGAGCTGTATCCTGAATCTAAAGTA
ATTATTCTATCAATTCACGATGACGAAAATTATGTAACACATGCCCTGAAAACAGGTGCAAGAGGTTATCTGCTGAAAGA
GATGGATGCTGATACATTAATTGAAGCGGTTAAAGTAGTGGCTGAGGGCGGATCTTACCTCCATCCGAAGGTTACTCACA
ACCTCGTTAACGAATTCCGCCGCCTTGCAACAAGCGGAGTTTCTGCACACCCTCAACATGAGGTTTACCCTGAAATCCGC
AGACCATTACATATTTTAACTAGGCGGGAATGTGAAGTGCTGCAGATGCTTGCAGACGGAAAAAGCAACCGCGGTATTGG
TGAATCATTGTTTATCAGTGAGAAAACCGTTAAAAACCATGTCAGCAATATTTTACAAAAAATGAATGTAAACGACCGGA
CGCAAGCCGTTGTGGTCGCCATTAAAAATGGCTGGGTAGAAATGAGATAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| vraR | Staphylococcus aureus N315 |
34.821 |
100 |
0.373 |
Multiple sequence alignment
References
| [1] | Kana Shimane et al. (2004) Mutational analysis of the helix-turn-helix region of Bacillus subtilis response regulator DegU, and identification of cis-acting sequences for DegU in the aprE and comK promoters. Journal of Biochemistry 136(3):387-97. [PMID: 15598897] |
| [2] | L W Hamoen et al. (2000) The pleiotropic response regulator DegU functions as a priming protein in competence development in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 97(16):9246-51. [PMID: 10908654] |
| [3] | M Ogura et al. (1996) Bacillus subtilis DegU acts as a positive regulator for comK expression. FEBS Letters 397(2-3):173-6. [PMID: 8955341] |
| [4] | F Kunst et al. (1994) The DegS/DegU and ComP/ComA two-component systems are part of a network controlling degradative enzyme synthesis and competence in Bacillus subtilis. Research in Microbiology 145(5-6):393-402. [PMID: 7855425] |