Detailed information NTG0000083

Experimentally validated

Overview

• Name: degU
• Type: Regulator
• Locus tag: BSU_35490
• Genome accession: NC_000964
• Coordinates: 3644607..3645296 (-)
• Length: 229 a.a.
• NCBI ID: NP_391429.1
• Uniprot ID: P13800
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: activation of comK Competence regulation

Function

The degU gene is part of the DegS-DegU two-component system. In its low phosphorylation state, DegU activates the expression of comK, the master regulator of competence. DegU binds specifically to the comK promoter, and strongly stimulates the binding of ComK to the comK promoter. Additionally, DegU regulates other processes such as biofilm formation, motility, and sporulation, highlighting its pleiotropic nature.

Genomic Context

Location: 3639607..3650296

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_35420 (BSU35420)	flgN	3639787..3640269 (-)	483	NP_391422.1	factor required for flagellar based motility	-
BSU_35430 (BSU35430)	flgM	3640285..3640551 (-)	267	NP_391423.1	anti-sigma factor repressor of sigma(D)-dependent transcription	-
BSU_35440 (BSU35440)	yvyF	3640632..3641051 (-)	420	NP_391424.1	putative transcriptional regulator of flagella formation	-
BSU_35450 (BSU35450)	comFC	3641125..3641847 (-)	723	NP_391425.2	component of the DNA transport apparatus	Machinery gene
BSU_35460 (BSU35460)	comFB	3641811..3642107 (-)	297	NP_391426.1	regulator of competence, pole located	-
BSU_35470 (BSU35470)	comFA	3642167..3643558 (-)	1392	NP_391427.1	ATP-dependent helicase competence protein	Machinery gene
BSU_35480 (BSU35480)	fakBA	3643664..3644509 (-)	846	NP_391428.1	fatty acid kinase fatty acid binding subunit A	-
BSU_35490 (BSU35490)	degU	3644607..3645296 (-)	690	NP_391429.1	two-component response regulator	Regulator
BSU_35500 (BSU35500)	degS	3645379..3646536 (-)	1158	NP_391430.1	two-component sensor histidine kinase [DegU]	Regulator
BSU_35510 (BSU35510)	yvyE	3646753..3647406 (+)	654	NP_391431.1	putative translation regulator	-
BSU_35520 (BSU35520)	tagV	3647406..3648581 (+)	1176	NP_391432.1	teichoic acid-peptidoglycan tethering enzyme (LCP component) with transcription regulator domain	-
BSU_35530 (BSU35530)	tagO	3648654..3649730 (-)	1077	NP_391433.1	UDP-N-acetylglucosamine:undecaprenyl-P N-acetylglucosaminyl-1-P transferase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
degU	comK	positive effect
comK	comK	positive effect
comK	late competence genes	positive effect
codY	comK	negative effect
clpP	comK	negative effect
mecA	comK	negative effect
kre	comK	negative effect
abrB	comK	negative effect
comS	comK	positive effect
spo0A	comK	positive effect
rok	comK	negative effect
clpC	comK	negative effect
med	comK	positive effect
spo0A	comK	negative effect
comK	late competence genes	positive effect
clpP	degU	negative effect
abrB	rok	negative effect
spo0A	abrB	negative effect
comA	comS	positive effect
spo0A	rok	negative effect
sinR	spo0A	negative effect
sinR	rok	negative effect
sinR	degU	negative effect
degQ	degU	positive effect
clpC	degU	negative effect
degS	degU	positive effect
rapC	comA	negative effect
rapF	comA	negative effect
comP	comA	positive effect
sinI	sinR	negative effect
phrC	rapC	negative effect
phrF	rapF	negative effect
comX	comP	positive effect
comQ	comX	positive effect

Sequence

Protein

• Length: 229 a.a.
• Molecular weight: 25866.57 Da
• Isoelectric Point: 5.9446

>NTDB_id=83 BSU_35490 NP_391429.1 3644607..3645296(-) (degU) [Bacillus subtilis subsp. subtilis str. 168]
MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDDGDEAARIVEHYHPDVVIMDINMPNVNGVEATKQLVELYPESKV
IILSIHDDENYVTHALKTGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYPEIR
RPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWVEMR

Nucleotide

• Length: 690 bp

>NTDB_id=83 BSU_35490 NP_391429.1 3644607..3645296(-) (degU) [Bacillus subtilis subsp. subtilis str. 168]
GTGACTAAAGTAAACATTGTTATTATCGACGACCATCAGTTATTTCGTGAAGGTGTTAAACGGATATTGGATTTTGAACC
TACCTTTGAAGTGGTAGCCGAAGGTGATGACGGGGACGAAGCGGCTCGTATTGTTGAGCACTATCATCCTGATGTTGTGA
TCATGGATATCAATATGCCAAACGTAAATGGTGTGGAAGCTACAAAACAGCTTGTAGAGCTGTATCCTGAATCTAAAGTA
ATTATTCTATCAATTCACGATGACGAAAATTATGTAACACATGCCCTGAAAACAGGTGCAAGAGGTTATCTGCTGAAAGA
GATGGATGCTGATACATTAATTGAAGCGGTTAAAGTAGTGGCTGAGGGCGGATCTTACCTCCATCCGAAGGTTACTCACA
ACCTCGTTAACGAATTCCGCCGCCTTGCAACAAGCGGAGTTTCTGCACACCCTCAACATGAGGTTTACCCTGAAATCCGC
AGACCATTACATATTTTAACTAGGCGGGAATGTGAAGTGCTGCAGATGCTTGCAGACGGAAAAAGCAACCGCGGTATTGG
TGAATCATTGTTTATCAGTGAGAAAACCGTTAAAAACCATGTCAGCAATATTTTACAAAAAATGAATGTAAACGACCGGA
CGCAAGCCGTTGTGGTCGCCATTAAAAATGGCTGGGTAGAAATGAGATAG

Domains

Predicted by InterproScan.

• Bacterial regulatory proteins, luxR family (GerE) (165-220)

• Response regulator receiver domain (Response_reg) (6-118)

3D structure

• AlphaFold DB: P13800

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
vraR	Staphylococcus aureus N315	34.821	100	0.373

References

• [1]: Kana Shimane et al. (2004) Mutational analysis of the helix-turn-helix region of Bacillus subtilis response regulator DegU, and identification of cis-acting sequences for DegU in the aprE and comK promoters. Journal of Biochemistry 136(3):387-97. [PMID: 15598897]
• [2]: L W Hamoen et al. (2000) The pleiotropic response regulator DegU functions as a priming protein in competence development in Bacillus subtilis. Proceedings of The National Academy of Sciences of The United States of America 97(16):9246-51. [PMID: 10908654]
• [3]: M Ogura et al. (1996) Bacillus subtilis DegU acts as a positive regulator for comK expression. FEBS Letters 397(2-3):173-6. [PMID: 8955341]
• [4]: F Kunst et al. (1994) The DegS/DegU and ComP/ComA two-component systems are part of a network controlling degradative enzyme synthesis and competence in Bacillus subtilis. Research in Microbiology 145(5-6):393-402. [PMID: 7855425]