Detailed information    

experimental Experimentally validated

Overview


Name   vraR   Type   Regulator
Locus tag   SA_RS09755 Genome accession   NC_002745
Coordinates   1946742..1947371 (-) Length   209 a.a.
NCBI ID   WP_000153535.1    Uniprot ID   Q7A2Q1
Organism   Staphylococcus aureus N315     
Function   repress expression of competence genes   
Competence regulation

Function


Compared with the parental strain, expression of PcomG-gfp was increased approximately 2.5-fold in the Δ12 strain, significantly lowered (approximately 4-fold) in the Δ13 TCS mutant, and, in strain Δ17, expression was completely abolished, indicating that TCS17 is essential for comG expression under these conditions.


Genomic Context


Location: 1941742..1952371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS09725 (SA1694) - 1942162..1942692 (-) 531 WP_000184383.1 acyl-CoA thioesterase -
  SA_RS09730 (SA1695) - 1942782..1944038 (-) 1257 WP_001795108.1 aminopeptidase -
  SA_RS09735 (SA1696) - 1944041..1944241 (-) 201 WP_000180460.1 DUF1128 family protein -
  SA_RS09740 (SA1697) - 1944388..1944852 (+) 465 WP_000228666.1 low molecular weight protein-tyrosine-phosphatase -
  SA_RS09745 (SA1698) - 1944859..1945134 (+) 276 WP_000428172.1 YtxH domain-containing protein -
  SA_RS09750 (SA1699) - 1945412..1946629 (+) 1218 WP_000037075.1 YihY/virulence factor BrkB family protein -
  SA_RS09755 (SA1700) vraR 1946742..1947371 (-) 630 WP_000153535.1 two-component system response regulator VraR Regulator
  SA_RS09760 (SA1701) vraS 1947361..1948404 (-) 1044 WP_001017131.1 sensor histidine kinase Regulator
  SA_RS09765 (SA1702) liaF 1948401..1949102 (-) 702 WP_000149064.1 cell wall-active antibiotics response protein LiaF -
  SA_RS09770 (SA1703) - 1949117..1949503 (-) 387 WP_001110179.1 hypothetical protein -
  SA_RS09775 (SA1704) map 1949720..1950478 (-) 759 WP_000636142.1 type I methionyl aminopeptidase -
  SA_RS09785 (SA1705) - 1951009..1951995 (+) 987 WP_000999717.1 FUSC family protein -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  vraR comGA negative effect
  agrA comGA positive effect
  agrA comGF positive effect
  agrA comGB positive effect
  agrA comGC positive effect
  agrA comGE positive effect
  agrA comGD positive effect
  comK/comK1 comGA positive effect
  comK/comK1 comGE positive effect
  comK/comK1 coiA positive effect
  comK/comK1 positive effect
  comK/comK1 comGD positive effect
  comK/comK1 comEA positive effect
  comK/comK1 ssb positive effect
  comK/comK1 comGB positive effect
  comK/comK1 dprA positive effect
  comK/comK1 comGF positive effect
  comK/comK1 comGC positive effect
  vraR comGF negative effect
  vraR comGB negative effect
  vraR comGC negative effect
  vraR comGE negative effect
  vraR comGD negative effect
  vraS comGA negative effect
  vraS comGC negative effect
  vraS comGE negative effect
  vraS comGD negative effect
  vraS comGF negative effect
  vraS comGB negative effect
  sigH comGA positive effect
  sigH comGD positive effect
  sigH comGF positive effect
  sigH comGC positive effect
  sigH comGE positive effect
  sigH coiA positive effect
  sigH positive effect
  sigH comEA positive effect
  sigH ssb positive effect
  sigH comGB positive effect
  sigH dprA positive effect
  agrC comGA positive effect
  agrC comGD positive effect
  agrC comGB positive effect
  agrC comGC positive effect
  agrC comGE positive effect
  agrC comGF positive effect
  braS comGA positive effect
  braS comGD positive effect
  braS comGB positive effect
  braS comGC positive effect
  braS comGE positive effect
  braS comGF positive effect
  braR comGA positive effect
  braR comGB positive effect
  braR comGD positive effect
  braR comGF positive effect
  braR comGC positive effect
  braR comGE positive effect

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 23559.32 Da        Isoelectric Point: 5.3935

>NTDB_id=4 SA_RS09755 WP_000153535.1 1946742..1947371(-) (vraR) [Staphylococcus aureus N315]
MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMEDMDGVEATTQIKKDLPQIKVL
MLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIA
KGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ

Nucleotide


Download         Length: 630 bp        

>NTDB_id=4 SA_RS09755 WP_000153535.1 1946742..1947371(-) (vraR) [Staphylococcus aureus N315]
ATGACGATTAAAGTATTGTTTGTGGATGATCATGAAATGGTACGTATAGGAATTTCAAGTTATCTATCAACGCAAAGTGA
TATTGAAGTAGTTGGTGAAGGCGCTTCTGGTAAAGAAGCAATTGCCAAAGCCCATGAGTTGAAGCCAGATTTAATTTTAA
TGGATTTACTTATGGAAGACATGGATGGTGTAGAAGCGACGACTCAGATTAAAAAAGATTTACCGCAAATTAAAGTATTA
ATGTTAACTAGTTTTATTGAAGATAAAGAGGTATATCGTGCATTAGATGCAGGTGTCGATAGTTACATTTTAAAAACAAC
AAGTGCAAAAGATATCGCCGATGCAGTTCGTAAAACTTCTAGAGGAGAATCTGTTTTTGAACCGGAAGTTTTAGTGAAAA
TGCGTAACCGTATGAAAAAGCGCGCAGAGTTATATGAAATGCTTACAGAACGAGAAATGGAAATATTATTATTGATTGCG
AAAGGTTACTCAAATCAAGAAATTGCTAGTGCATCGCATATTACTATTAAAACGGTTAAGACACATGTGAGTAACATTTT
AAGTAAGTTAGAAGTGCAAGATAGAACACAAGCTGTCATCTATGCATTCCAACATAATTTAATTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 2RNJ
  PDB 4GVP
  PDB 4IF4
  PDB 7VE6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degU Bacillus subtilis subsp. subtilis str. 168

34.821

100

0.373


Multiple sequence alignment    



References


[1] Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]