Detailed information NTG0000009

Experimentally validated

Overview

• Name: braR
• Type: Regulator
• Locus tag: SA_RS13865
• Genome accession: NC_002745
• Coordinates: 2713922..2714587 (-)
• Length: 221 a.a.
• NCBI ID: WP_000697877.1
• Uniprot ID: A0A0D1JN68
• Organism: Staphylococcus aureus N315
• Function: promote expression of competence genes Competence regulation

Function

Compared with the parental strain, expression of PcomG-gfp was increased approximately 2.5-fold in the Δ12 strain, significantly lowered (approximately 4-fold) in the Δ13 TCS mutant, and, in strain Δ17, expression was completely abolished, indicating that TCS17 is essential for comG expression under these conditions.

Genomic Context

Location: 2708922..2719587

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA_RS13840	-	2709392..2709505 (-)	114	Protein_2612	hypothetical protein	-
SA_RS13850 (SA2415)	-	2710164..2712164 (-)	2001	WP_000776751.1	ABC transporter permease	-
SA_RS13855 (SA2416)	-	2712161..2712916 (-)	756	WP_000923760.1	ABC transporter ATP-binding protein	-
SA_RS13860 (SA2417)	braS	2713024..2713911 (-)	888	WP_000143425.1	nisin susceptibility-associated two-component system sensor histidine kinase NsaS	Regulator
SA_RS13865 (SA2418)	braR	2713922..2714587 (-)	666	WP_000697877.1	nisin susceptibility-associated two-component system response regulator NsaR	Regulator
SA_RS13870 (SA2419)	-	2714613..2714813 (-)	201	WP_000604730.1	hypothetical protein	-
SA_RS13880 (SA2420)	-	2715011..2716435 (+)	1425	WP_000953755.1	alkaline phosphatase	-
SA_RS15560	-	2716495..2716596 (-)	102	WP_000731976.1	SE2200 family small protein	-
SA_RS13885 (SA2421)	-	2716718..2717173 (-)	456	WP_000106185.1	MarR family winged helix-turn-helix transcriptional regulator	-
SA_RS13890 (SA2422)	-	2717418..2718179 (-)	762	WP_000323441.1	alpha/beta hydrolase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
braR	comGB	positive effect
braR	comGD	positive effect
braR	comGA	positive effect
braR	comGF	positive effect
braR	comGC	positive effect
braR	comGE	positive effect
sigH	comGB	positive effect
sigH	comGD	positive effect
sigH	comGA	positive effect
sigH	comGF	positive effect
sigH	comGC	positive effect
sigH	comGE	positive effect
sigH	coiA	positive effect
sigH		positive effect
sigH	comEA	positive effect
sigH	ssb	positive effect
sigH	dprA	positive effect
agrC	comGB	positive effect
agrC	comGD	positive effect
agrC	comGC	positive effect
agrC	comGE	positive effect
agrC	comGA	positive effect
agrC	comGF	positive effect
braS	comGB	positive effect
braS	comGD	positive effect
braS	comGC	positive effect
braS	comGE	positive effect
braS	comGA	positive effect
braS	comGF	positive effect
vraS	comGB	negative effect
vraS	comGC	negative effect
vraS	comGE	negative effect
vraS	comGD	negative effect
vraS	comGA	negative effect
vraS	comGF	negative effect
agrA	comGB	positive effect
agrA	comGA	positive effect
agrA	comGF	positive effect
agrA	comGC	positive effect
agrA	comGE	positive effect
agrA	comGD	positive effect
comK/comK1	comGB	positive effect
comK/comK1	comGE	positive effect
comK/comK1	coiA	positive effect
comK/comK1		positive effect
comK/comK1	comGD	positive effect
comK/comK1	comEA	positive effect
comK/comK1	ssb	positive effect
comK/comK1	dprA	positive effect
comK/comK1	comGA	positive effect
comK/comK1	comGF	positive effect
comK/comK1	comGC	positive effect
vraR	comGB	negative effect
vraR	comGA	negative effect
vraR	comGF	negative effect
vraR	comGC	negative effect
vraR	comGE	negative effect
vraR	comGD	negative effect

Sequence

Protein

• Length: 221 a.a.
• Molecular weight: 25415.49 Da
• Isoelectric Point: 4.7961

>NTDB_id=9 SA_RS13865 WP_000697877.1 2713922..2714587(-) (braR) [Staphylococcus aureus N315]
MKILIVEDDFVIAESLASELKKWNYGVIVVEQFDDILSIFNQHQPQLVLLDINLPTLNGFHWCQEIRKTSNVPIIFISSR
IDNMDQIMAIQMGGDDFIEKPFNLSLTIAKIQALLRRTYDLSVANDSLTVKGCTLILDEAKVVYQEQNIQLSLTELQILK
LLFQNEDKYVSRTALIEKCWESENFIDDNTLAVNMTRLRKKLNTIGVNDFIITKKNVGYKV

Nucleotide

• Length: 666 bp

>NTDB_id=9 SA_RS13865 WP_000697877.1 2713922..2714587(-) (braR) [Staphylococcus aureus N315]
ATGAAAATATTAATTGTTGAAGATGATTTTGTTATAGCAGAAAGTTTAGCATCTGAACTTAAAAAATGGAATTACGGTGT
TATTGTCGTTGAACAATTTGATGATATACTGTCTATCTTTAACCAACATCAACCTCAGCTTGTATTGCTAGATATTAATT
TGCCAACGTTAAATGGTTTTCATTGGTGTCAAGAAATCCGAAAAACATCTAATGTGCCAATTATATTTATTAGTTCCCGT
ATTGATAATATGGACCAAATTATGGCAATACAAATGGGGGGAGATGATTTTATCGAAAAGCCATTTAACTTGTCATTAAC
GATTGCCAAAATTCAAGCATTATTGAGACGAACTTATGACTTGTCAGTAGCTAATGATTCATTGACGGTTAAAGGTTGTA
CATTAATATTAGATGAAGCAAAAGTCGTGTATCAAGAACAAAACATACAGCTATCTTTGACTGAATTACAAATATTAAAG
TTATTATTTCAAAATGAAGATAAATATGTAAGTAGAACTGCTTTAATTGAAAAATGTTGGGAATCAGAAAACTTCATAGA
TGATAACACATTAGCTGTTAACATGACGCGCCTGCGTAAAAAATTAAATACTATTGGCGTTAATGATTTTATCATTACAA
AGAAAAATGTCGGATATAAAGTATAG

Domains

Predicted by InterproScan.

• Response regulator receiver domain (Response_reg) (3-111)

• Transcriptional regulatory protein, C terminal (Trans_reg_C) (147-220)

3D structure

• AlphaFold DB: A0A0D1JN68

References

• [1]: Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]