Detailed information NTG0000017

Experimentally validated

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: SA_RS07760
• Genome accession: NC_002745
• Coordinates: 1578408..1578854 (-)
• Length: 148 a.a.
• NCBI ID: WP_001788899.1
• Uniprot ID: -
• Organism: Staphylococcus aureus N315
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake

Function

In addition, the staphylococcal comG operon contains a homologue to the gene encoding the major pilins of S. pneumoniae and B. subtilis (comGC) and three small open reading frames (comGD, comGE and comGF) encoding minor pilin subunits.

Genomic Context

Location: 1573408..1583854

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA_RS07730 (SA1366)	gcvPA	1574334..1575680 (-)	1347	WP_000019691.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
SA_RS07735 (SA1367)	gcvT	1575700..1576791 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
SA_RS07740 (SA1368)	-	1576950..1577474 (-)	525	WP_001015120.1	shikimate kinase	-
SA_RS07745	-	1577464..1577610 (-)	147	WP_001792109.1	hypothetical protein	-
SA_RS07750	comGF	1577707..1578204 (-)	498	WP_001788897.1	competence type IV pilus minor pilin ComGF	Machinery gene
SA_RS07755 (SA1370)	comGE	1578122..1578421 (-)	300	WP_000844410.1	hypothetical protein	Machinery gene
SA_RS07760 (SA1371)	comGD	1578408..1578854 (-)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
SA_RS07765 (SA1372)	comGC	1578832..1579143 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
SA_RS07770 (SA1373)	comGB	1579157..1580227 (-)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
SA_RS07775 (SA1374)	comGA	1580199..1581173 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
SA_RS07780 (SA1375)	-	1581225..1581848 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
SA_RS07785 (SA1376)	-	1581845..1582174 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
SA_RS07790 (SA1377)	-	1582174..1583160 (-)	987	WP_000161311.1	ROK family glucokinase	-
SA_RS07795 (SA1378)	-	1583157..1583360 (-)	204	WP_000087561.1	YqgQ family protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
agrC	comGD	positive effect
braS	comGD	positive effect
sigH	comGD	positive effect
braR	comGD	positive effect
vraR	comGD	negative effect
agrA	comGD	positive effect
comK/comK1	comGD	positive effect
vraS	comGD	negative effect
agrC	comGB	positive effect
braR	comGB	positive effect
sigH	comGB	positive effect
braS	comGB	positive effect
vraS	comGB	negative effect
agrA	comGB	positive effect
comK/comK1	comGB	positive effect
vraR	comGB	negative effect
agrC	comGC	positive effect
vraS	comGC	negative effect
agrA	comGC	positive effect
comK/comK1	comGC	positive effect
vraR	comGC	negative effect
braR	comGC	positive effect
sigH	comGC	positive effect
braS	comGC	positive effect
agrC	comGE	positive effect
vraS	comGE	negative effect
agrA	comGE	positive effect
comK/comK1	comGE	positive effect
vraR	comGE	negative effect
braR	comGE	positive effect
sigH	comGE	positive effect
braS	comGE	positive effect
agrC	comGA	positive effect
agrA	comGA	positive effect
comK/comK1	comGA	positive effect
vraR	comGA	negative effect
vraS	comGA	negative effect
sigH	comGA	positive effect
braS	comGA	positive effect
braR	comGA	positive effect
agrC	comGF	positive effect
agrA	comGF	positive effect
comK/comK1	comGF	positive effect
vraR	comGF	negative effect
vraS	comGF	negative effect
sigH	comGF	positive effect
braS	comGF	positive effect
braR	comGF	positive effect
sigH	coiA	positive effect
comK/comK1	coiA	positive effect
sigH		positive effect
comK/comK1		positive effect
sigH	comEA	positive effect
comK/comK1	comEA	positive effect
sigH	ssb	positive effect
comK/comK1	ssb	positive effect
sigH	dprA	positive effect
comK/comK1	dprA	positive effect

Sequence

Protein

• Length: 148 a.a.
• Molecular weight: 17165.33 Da
• Isoelectric Point: 10.3312

>NTDB_id=17 SA_RS07760 WP_001788899.1 1578408..1578854(-) (comGD) [Staphylococcus aureus N315]
MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSD
TIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIDNNNSIYRIIFHIEKGRIRYEKL

Nucleotide

• Length: 447 bp

>NTDB_id=17 SA_RS07760 WP_001788899.1 1578408..1578854(-) (comGD) [Staphylococcus aureus N315]
ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTGGTAATGATGTTAATCAGTAT
ATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAATCTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTA
TTACTGAATTGAATTATATTAAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
ACTATTAAAGTAATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATAATTAATGTTGCAAAAGTTGA
TATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTTGGTAGCATAACAATTGACAATAACAATTCAATTTATAGAA
TAATATTCCATATTGAAAAAGGAAGAATTCGTTATGAAAAGCTATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Staphylococcus aureus MW2	100	100	1

References

• [1]: Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]
• [2]: Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]
• [3]: Kazuya Morikawa et al. (2003) A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes. Genes To Cells : Devoted To Molecular & Cellular Mechanisms 8(8):699-712. [PMID: 12875655]