Detailed information NTG0000005

Experimentally validated

Overview

• Name: vraS
• Type: Regulator
• Locus tag: SA_RS09760
• Genome accession: NC_002745
• Coordinates: 1947361..1948404 (-)
• Length: 347 a.a.
• NCBI ID: WP_001017131.1
• Uniprot ID: A0A0D1IMN4
• Organism: Staphylococcus aureus N315
• Function: repress expression of competence genes Competence regulation

Function

Compared with the parental strain, expression of PcomG-gfp was increased approximately 2.5-fold in the Δ12 strain, significantly lowered (approximately 4-fold) in the Δ13 TCS mutant, and, in strain Δ17, expression was completely abolished, indicating that TCS17 is essential for comG expression under these conditions.

Genomic Context

Location: 1942361..1953404

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA_RS09730 (SA1695)	-	1942782..1944038 (-)	1257	WP_001795108.1	aminopeptidase	-
SA_RS09735 (SA1696)	-	1944041..1944241 (-)	201	WP_000180460.1	DUF1128 family protein	-
SA_RS09740 (SA1697)	-	1944388..1944852 (+)	465	WP_000228666.1	low molecular weight protein-tyrosine-phosphatase	-
SA_RS09745 (SA1698)	-	1944859..1945134 (+)	276	WP_000428172.1	YtxH domain-containing protein	-
SA_RS09750 (SA1699)	-	1945412..1946629 (+)	1218	WP_000037075.1	YihY/virulence factor BrkB family protein	-
SA_RS09755 (SA1700)	vraR	1946742..1947371 (-)	630	WP_000153535.1	two-component system response regulator VraR	Regulator
SA_RS09760 (SA1701)	vraS	1947361..1948404 (-)	1044	WP_001017131.1	sensor histidine kinase	Regulator
SA_RS09765 (SA1702)	liaF	1948401..1949102 (-)	702	WP_000149064.1	cell wall-active antibiotics response protein LiaF	-
SA_RS09770 (SA1703)	-	1949117..1949503 (-)	387	WP_001110179.1	hypothetical protein	-
SA_RS09775 (SA1704)	map	1949720..1950478 (-)	759	WP_000636142.1	type I methionyl aminopeptidase	-
SA_RS09785 (SA1705)	-	1951009..1951995 (+)	987	WP_000999717.1	FUSC family protein	-
SA_RS09790 (SA1706)	-	1952426..1952839 (-)	414	WP_001557448.1	hypothetical protein	-
SA_RS09795	-	1952868..1952978 (-)	111	WP_001790257.1	hypothetical protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
vraS	comGC	negative effect
vraS	comGE	negative effect
vraS	comGD	negative effect
vraS	comGA	negative effect
vraS	comGF	negative effect
vraS	comGB	negative effect
agrA	comGC	positive effect
agrA	comGA	positive effect
agrA	comGF	positive effect
agrA	comGB	positive effect
agrA	comGE	positive effect
agrA	comGD	positive effect
comK/comK1	comGC	positive effect
comK/comK1	comGE	positive effect
comK/comK1	coiA	positive effect
comK/comK1		positive effect
comK/comK1	comGD	positive effect
comK/comK1	comEA	positive effect
comK/comK1	ssb	positive effect
comK/comK1	comGB	positive effect
comK/comK1	dprA	positive effect
comK/comK1	comGA	positive effect
comK/comK1	comGF	positive effect
vraR	comGC	negative effect
vraR	comGA	negative effect
vraR	comGF	negative effect
vraR	comGB	negative effect
vraR	comGE	negative effect
vraR	comGD	negative effect
braR	comGC	positive effect
braR	comGB	positive effect
braR	comGD	positive effect
braR	comGA	positive effect
braR	comGF	positive effect
braR	comGE	positive effect
sigH	comGC	positive effect
sigH	comGD	positive effect
sigH	comGA	positive effect
sigH	comGF	positive effect
sigH	comGE	positive effect
sigH	coiA	positive effect
sigH		positive effect
sigH	comEA	positive effect
sigH	ssb	positive effect
sigH	comGB	positive effect
sigH	dprA	positive effect
agrC	comGC	positive effect
agrC	comGD	positive effect
agrC	comGB	positive effect
agrC	comGE	positive effect
agrC	comGA	positive effect
agrC	comGF	positive effect
braS	comGC	positive effect
braS	comGD	positive effect
braS	comGB	positive effect
braS	comGE	positive effect
braS	comGA	positive effect
braS	comGF	positive effect

Sequence

Protein

• Length: 347 a.a.
• Molecular weight: 40044.52 Da
• Isoelectric Point: 6.0577

>NTDB_id=5 SA_RS09760 WP_001017131.1 1947361..1948404(-) (vraS) [Staphylococcus aureus N315]
MNHYIRTIGSMLILVYSMLAAFLFIDKVFVNIIYFQGMFYTQIFGIPVFLFLNLIIILLCIIVGSVLAYKINQQNDWIKT
QIERSMEGETVGINDQNIEIYSETLDLYHTLVPLNQELHKLRLKTQNLTNENYNINDVKVKKIIEDERQRLARELHDSVS
QQLFAASMMLSAIKETKLEPPLDQQIPILEKMVQDSQLEMRALLLHLRPLGLKDKSLGEGIKDLVIDLQKKVPMKVVHEI
QDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEKLEQSYGLKNMRERALEIGAT
FHIVSLPDSGTRIEVKAPLNKEDSYDD

Nucleotide

• Length: 1044 bp

>NTDB_id=5 SA_RS09760 WP_001017131.1 1947361..1948404(-) (vraS) [Staphylococcus aureus N315]
ATGAACCACTACATTAGAACAATTGGTTCAATGCTCATCTTAGTATATAGCATGCTAGCTGCATTTCTATTCATCGATAA
AGTTTTTGTAAATATCATCTATTTTCAAGGTATGTTTTATACACAAATATTCGGAATACCAGTCTTTTTATTTTTAAATC
TCATCATCATATTATTGTGTATTATTGTTGGTTCGGTACTCGCATACAAAATCAATCAGCAAAATGATTGGATTAAGACG
CAAATTGAGCGTTCAATGGAAGGCGAAACAGTTGGCATTAATGATCAAAATATAGAAATATATAGTGAAACGTTAGATTT
ATACCATACACTCGTACCTTTAAATCAAGAATTGCATAAGTTGCGACTTAAAACTCAAAACTTAACCAATGAAAATTATA
ATATTAATGATGTGAAAGTTAAAAAGATTATTGAAGATGAACGTCAAAGACTAGCTCGAGAACTTCACGATTCTGTTAGT
CAGCAACTTTTTGCGGCAAGTATGATGCTTTCTGCTATCAAAGAAACGAAGTTAGAACCACCATTAGACCAACAAATTCC
GATTTTAGAGAAAATGGTTCAAGATTCGCAGTTAGAAATGCGTGCTTTGCTGTTACATTTAAGACCGCTTGGTTTAAAAG
ACAAATCTTTAGGTGAGGGTATTAAAGATTTAGTTATTGATTTACAAAAAAAAGTGCCAATGAAAGTTGTGCATGAAATA
CAAGATTTTAAAGTGCCTAAAGGTATTGAAGATCATTTGTTCAGAATTACACAGGAAGCAATTTCGAATACATTGCGTCA
TTCAAACGGTACAAAAGTGACAGTAGAATTGTTTAATAAAGACGATTATTTATTGTTGAGAATTCAAGATAATGGTAAAG
GTTTTAATGTTGATGAAAAATTAGAACAAAGTTATGGACTTAAAAATATGCGTGAAAGAGCTTTGGAAATTGGTGCAACG
TTCCATATTGTATCATTGCCAGATTCAGGTACACGTATCGAGGTGAAAGCACCTTTAAATAAGGAGGATTCGTATGACGA
TTAA

Domains

Predicted by InterproScan.

• Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (HATPase_c) (249-340)

• Histidine kinase (HisKA_3) (147-210)

3D structure

• AlphaFold DB: A0A0D1IMN4

References

• [1]: Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]